Gene Information

Name : Csac_2034 (Csac_2034)
Accession : YP_001180810.1
Strain : Caldicellulosiruptor saccharolyticus DSM 8903
Genome accession: NC_009437
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2177768 - 2178466 bp
Length : 699 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAAAAATATTTTGATTGTGGATGATGAACCCCATATCGTTGAATTAATTAAATTCAATCTTCAAAAAGAAGGCTATAA
TACTTTTGAAGCTGAAAATGGCAACACAGCTTTGGATATTATCAAAAATAACAAGATTGACCTAGTGATACTTGATATAA
TGATGAGTGATAAGGACGGATATGAGGTTTTAAAAGAGATTAGGTTTAACAAAGGAACAAGAAACCTTCCGGTTATATTA
CTTTCTGCAAAGTCAGAAGAAATTGACAGAATATTAGGTCTCGAACTTGGAGCAGATGACTACATAACAAAGCCATTTAG
TGTAAAAGAACTTGTAGCAAGGGTAAAGGCCCTTTTTAGGAGAATTGAAAATTTAAAACCTGAGGTTGAAGAAAAGATTA
GATTTGGTGATATTGAGGTAGATTTTACAAAAAGAAGTGTGAAGAAGAGAAATCAAGAAATTAGTCTTTCTTTTAAGGAA
TTTGAGCTTTTAAAGCTGCTGATAGAAAACAGAGGAAGAGTTTTGGACAGAGATTTCATTTTGCAAAGAGTATGGGGATA
TGAGTTTGATGGTGATTCTCGAACAGTTGATGTGCATATAAGATTTTTAAGGAGAAAACTTGAAGATGACGAAAAGAATC
CTAAGTATATTGAGACAGTAAGAGGAGTTGGCTACAGATTTAGAGAAGGGTCTGACTAA

Protein sequence :
MKNILIVDDEPHIVELIKFNLQKEGYNTFEAENGNTALDIIKNNKIDLVILDIMMSDKDGYEVLKEIRFNKGTRNLPVIL
LSAKSEEIDRILGLELGADDYITKPFSVKELVARVKALFRRIENLKPEVEEKIRFGDIEVDFTKRSVKKRNQEISLSFKE
FELLKLLIENRGRVLDRDFILQRVWGYEFDGDSRTVDVHIRFLRRKLEDDEKNPKYIETVRGVGYRFREGSD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-34 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-29 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-43 51
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-43 51
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-43 51
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-43 50
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-40 48
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-43 47
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 47
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-38 45
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-37 45
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-37 44
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-29 42
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-32 42
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-29 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 6e-30 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-25 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-27 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-30 43
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-34 42
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator VFG1386 Protein 9e-36 42
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-34 41
Csac_2034 YP_001180810.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-33 41