Gene Information

Name : Csac_2003 (Csac_2003)
Accession : YP_001180779.1
Strain : Caldicellulosiruptor saccharolyticus DSM 8903
Genome accession: NC_009437
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2151006 - 2151677 bp
Length : 672 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAAAATATTGGTCATTGATGATGATGTTAAGATTTGTGAGGTTATTAAACTGTATTTAGAAAAAGAAGGTTTTGAAGT
TATAATTGCTCACAACGGTAGCGACGGTATAACCATGTTCAAACACGAGATGCCGGATTTGGTCATACTTGATATTATGC
TCCCTAAGAAAGATGGGTATGAAGTATGTAGAGAAATCAGAAAAATTAGTAATATTCCAATTATAATGCTCACTGCTAAA
GGTGAAACATTTGATAAGGTATTGGGTTTAGAGCTTGGAGCAGATGATTATATTGTCAAGCCCTTTGATCCAAAAGAACT
CATTGCAAGAATAAAGGCTGTGTTAAGAAGAACTCAAGGTGAAGTGAATGACGAGAAGGTGGTTGTTTATCCTAATCTTA
CCATCAATTTGACTACATACGAGGTAAAGCTTGAGGACAAGATTATAGAGATGCCACCAAAAGAGATAGAGCTTTTATAT
TTTTTGGCTTCTCATCCTAACAAGGTATTTACACGTGAACAGCTTCTTGACCACATATGGGGTTACAACTTTGTGGGCGA
TACCAGAACTGTTGATGTTCATATTAAAAGGATTAGGGAAAAAATAGAAAAGGATAAATACCCTTGGCGTATCAAAACTG
TTTGGGGTGTTGGTTATAAATTTGAGATTTGA

Protein sequence :
MKILVIDDDVKICEVIKLYLEKEGFEVIIAHNGSDGITMFKHEMPDLVILDIMLPKKDGYEVCREIRKISNIPIIMLTAK
GETFDKVLGLELGADDYIVKPFDPKELIARIKAVLRRTQGEVNDEKVVVYPNLTINLTTYEVKLEDKIIEMPPKEIELLY
FLASHPNKVFTREQLLDHIWGYNFVGDTRTVDVHIKRIREKIEKDKYPWRIKTVWGVGYKFEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-37 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-49 50
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-44 50
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-48 48
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-42 47
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-41 47
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-38 46
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-32 45
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-42 44
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-34 43
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 7e-35 42
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 3e-37 42
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 9e-34 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 9e-34 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 5e-33 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 7e-37 41
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-37 42
Csac_2003 YP_001180779.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-37 42