|
Name : rpmJ (Ent638_0935) Accession : YP_001175670.1 Strain : Enterobacter sp. 638 Genome accession: NC_009436 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0257 EC number : - Position : 1040066 - 1040206 bp Length : 141 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGCAGGTACTTAACTCGCTACGCAGCGCCAAACAGCGTCATCCGGACTGCCAGATCGTAAAACGCAAAGGACGCCTGTA CGTGATTTGCAAATCTAACCCGCGCTTTAAAGCGGTGCAGGGAAGAAAGAAAAGACGTTAA Protein sequence : MQVLNSLRSAKQRHPDCQIVKRKGRLYVICKSNPRFKAVQGRKKRR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 1e-04 | 57 |
