Gene Information

Name : Ent638_1997 (Ent638_1997)
Accession : YP_001176724.1
Strain : Enterobacter sp. 638
Genome accession: NC_009436
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator MarA
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 2170471 - 2170854 bp
Length : 384 bp
Strand : -
Note : transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype; also activates sodA, zwf and micF

DNA sequence :
ATGTCCAGACGCAATAATGACGCCATCACTATTCATAGCATTTTGGACTGGATCGAAGATAACCTGGAATCGCCGCTCTC
ACTTGAAAAGGTGTCCGAGCGTTCAGGTTACTCAAAATGGCACCTGCAACGGATGTTCAAAAAAGAGACCGGTCATTCAT
TAGGTCAATACATTCGCAGCCGCAAGCTGACGGAAATTGCTCAGAAGCTGAAAGAGAGCAACGAACCGATCCTGTATCTG
GCAGAACGCTATGGGTTTGAATCGCAACAAACCTTGACCCGCACGTTCAAGAACTATTTCGACGTGCCACCGCATAAGTA
TCGCATCACCAGTATGCCTGGTGAGTCCCGATACCTGCTACCGCTAACGAACTGTCATTGCTAA

Protein sequence :
MSRRNNDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKLTEIAQKLKESNEPILYL
AERYGFESQQTLTRTFKNYFDVPPHKYRITSMPGESRYLLPLTNCHC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 5e-21 45
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 5e-21 45
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 9e-20 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP001918.1.gene2033. Protein 2e-53 96
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP000647.1.gene1624. Protein 1e-52 96
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP001138.1.gene1637. Protein 3e-53 93
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA BAC0560 Protein 1e-52 91
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA NC_002695.1.917339.p Protein 1e-52 91
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP000034.1.gene1596. Protein 2e-52 90
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP001138.1.gene612.p Protein 1e-22 46
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA NC_010558.1.6276025. Protein 2e-21 45
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP001138.1.gene4488. Protein 3e-20 43
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA NC_002695.1.914293.p Protein 1e-19 43
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP000034.1.gene4505. Protein 2e-19 43
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA BAC0371 Protein 1e-19 43
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP001918.1.gene327.p Protein 2e-20 43
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA CP000647.1.gene4499. Protein 5e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA VFG1038 Protein 2e-21 45
Ent638_1997 YP_001176724.1 DNA-binding transcriptional activator MarA VFG0585 Protein 3e-20 43