Gene Information

Name : Ent638_1890 (Ent638_1890)
Accession : YP_001176618.1
Strain : Enterobacter sp. 638
Genome accession: NC_009436
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 2049500 - 2049862 bp
Length : 363 bp
Strand : -
Note : PFAM: helix-turn-helix- domain containing protein, AraC type; KEGG: eca:ECA3896 right origin-binding protein

DNA sequence : 
ATGAACACTGGCGCATTTATGCATGATTTACTCGACTGGATCGATAACAACCTGGATAGCCGTCTGGACATTGAGTCCGT
CGCCAGGCGATCCGGTTATTCAAAGTGGCACCTCCAGCGGCTGTTCAAAGAACATACGGGTTATCCCCTCGCCGGGTATA
TCCGCGCGCAAAAGCTGCAAAAATCGGTTGAACGCTTAACCCACAGCGATGAACCGATTCTGAACGTGGCGATCGCGCTG
GGCTTTGACTCCCAGCAGTCCTTCAATCGCAGCTTTAAGCGTCTGTACGGTCAGGCACCTGGCGCATGGAGGCGTAGCAT
AGGTGACCCACAAACGCAGCAGCTAAGCCTGCAATCAAGGTAG

Protein sequence : 
MNTGAFMHDLLDWIDNNLDSRLDIESVARRSGYSKWHLQRLFKEHTGYPLAGYIRAQKLQKSVERLTHSDEPILNVAIAL
GFDSQQSFNRSFKRLYGQAPGAWRRSIGDPQTQQLSLQSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 5e-19 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 5e-19 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 6e-23 50
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 6e-23 49
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 8e-23 49
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 6e-23 48
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator BAC0560 Protein 6e-23 48
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 5e-23 48
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 2e-19 46
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 7e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_1890 YP_001176618.1 AraC family transcriptional regulator VFG1038 Protein 2e-19 46