Gene Information

Name : Ent638_1078 (Ent638_1078)
Accession : YP_001175810.1
Strain : Enterobacter sp. 638
Genome accession: NC_009436
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 1180857 - 1181198 bp
Length : 342 bp
Strand : +
Note : PFAM: helix-turn-helix- domain containing protein, AraC type; KEGG: spt:SPA2153 transcriptional activator RamA

DNA sequence :
ATGACTATTTCCGCTCAGGTCATCGATACTATCGTCGAATGGATTGACGATAATCTTCATCAGCCGCTGCGCATTGAAGA
GATCGCCCGCCACGCGGGGTATTCCAAATGGCATTTGCAGCGTCTGTTTATGCAATACAAAGGCGAAAGCCTGGGGCGTT
ATATTCGCGAGCGTAAATTGCTGCTGGCGGCGAAGGATCTGCGTGAATCGGACGAGCGGGTGTACGACATCTGTCTGCGC
TACGGGTTTGATTCTCAGCAGACGTTTACCCGCATCTTCACGCGTACGTTCAACCTGCCACCAGGTGCGTACCGCAAAGA
AAATCATAGCCAGACGCACTGA

Protein sequence :
MTISAQVIDTIVEWIDDNLHQPLRIEEIARHAGYSKWHLQRLFMQYKGESLGRYIRERKLLLAAKDLRESDERVYDICLR
YGFDSQQTFTRIFTRTFNLPPGAYRKENHSQTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 3e-19 49
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-16 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-16 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 5e-41 88
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 9e-19 51
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 5e-19 50
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 4e-19 50
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 9e-20 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 1e-19 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 1e-19 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 3e-19 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator BAC0560 Protein 3e-19 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 2e-19 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator BAC0371 Protein 1e-18 46
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 1e-18 46
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 2e-18 45
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 7e-17 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator VFG0585 Protein 1e-19 49
Ent638_1078 YP_001175810.1 AraC family transcriptional regulator VFG1038 Protein 6e-17 43