Gene Information

Name : PST_3472 (PST_3472)
Accession : YP_001173942.1
Strain : Pseudomonas stutzeri A1501
Genome accession: NC_009434
Putative virulence/resistance : Unknown
Product : ISPsy5, Orf1
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3757179 - 3757523 bp
Length : 345 bp
Strand : -
Note : Code: L; COG: COG3436

DNA sequence :
ATGATCGGTCTGGATAGCCAGGCCCGGATCTGGCTGTGCACCGAGCCCACGGATATGCGCAAATCCTTCCGGGGGCTGAG
CGCTCTGGTCCGCAATCAACTCAAGCAAGATCCGCTCAGCGGGCAGTATTTTGTCTTCGTTAACCGTCGCAAGACCCAAA
TGAAGATGTTGTATTTCACGCCCACGGGCTACTGCCTGTGGGCCAAGCGACTGGAGCAGGGGCAGTTCCGGGTACGGCCG
TCTTCTTCGGGACAGCGCCCCTTAAACCTGACTGATCTCCAGTTGCTGATTGACGGTATCGAGGTGCAAAAGTACCGTCA
GTTCAAGCGTTTTCGGGGCACGTAG

Protein sequence :
MIGLDSQARIWLCTEPTDMRKSFRGLSALVRNQLKQDPLSGQYFVFVNRRKTQMKMLYFTPTGYCLWAKRLEQGQFRVRP
SSSGQRPLNLTDLQLLIDGIEVQKYRQFKRFRGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-15 47
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-18 45
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-17 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-17 44
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-17 44
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-17 44
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-17 44
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-17 44
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-17 44
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-17 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-17 44
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-17 44
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-15 44
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-18 44
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-18 44
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-16 43
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-16 43
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-17 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-14 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-14 42
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-16 42
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-16 42
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-15 41
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-16 41
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG1517 Protein 3e-15 47
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG1052 Protein 3e-18 45
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG0792 Protein 5e-18 44
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG1698 Protein 6e-18 44
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG1709 Protein 5e-18 44
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG1665 Protein 1e-17 43
PST_3472 YP_001173942.1 ISPsy5, Orf1 VFG1737 Protein 5e-17 41