Gene Information

Name : PST_3433 (PST_3433)
Accession : YP_001173903.1
Strain : Pseudomonas stutzeri A1501
Genome accession: NC_009434
Putative virulence/resistance : Resistance
Product : periplasmic transport protein; MerP
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 3707081 - 3707356 bp
Length : 276 bp
Strand : +
Note : -

DNA sequence :
ATGCGCAAACTGCTGATCGCCGTGCTTTTCGCCTTGCCCTTCGTGGCGCTGGCGGCTCCCCCGAAAACCGTCACGCTCGA
CGTGCAGAACATGACGTGCGGACTCTGTCCGATCACGGTCAAGAAGTCGCTGGAGAAGGTGTCCGGCGTGAGTGACGTCC
AGGTCAATTTCGACCAGAAGACGGCGACCGTCACCTACGATCCCGATAAGGCCCAGCCCGAGGCACTGACTGAGGCGACC
GCGAACGCGGGATACCCCTCCACAGTGCAGAAGTGA

Protein sequence :
MRKLLIAVLFALPFVALAAPPKTVTLDVQNMTCGLCPITVKKSLEKVSGVSDVQVNFDQKTATVTYDPDKAQPEALTEAT
ANAGYPSTVQK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-15 61
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-15 61
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-15 61
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-15 61
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-15 61
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-15 61
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 3e-16 58
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-14 54
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 3e-14 54
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 6e-15 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PST_3433 YP_001173903.1 periplasmic transport protein; MerP BAC0678 Protein 4e-15 58
PST_3433 YP_001173903.1 periplasmic transport protein; MerP BAC0231 Protein 2e-15 57
PST_3433 YP_001173903.1 periplasmic transport protein; MerP BAC0679 Protein 1e-15 56
PST_3433 YP_001173903.1 periplasmic transport protein; MerP BAC0675 Protein 5e-15 54
PST_3433 YP_001173903.1 periplasmic transport protein; MerP BAC0674 Protein 3e-14 52