Gene Information

Name : Rsph17025_4304 (Rsph17025_4304)
Accession : YP_001170454.1
Strain :
Genome accession: NC_009431
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 60906 - 61259 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
GTGATCCTGCCGGGCGGGATCAACCGGGCCTATCTGGCGACGCGGCCGGTCGATTTCAGGAAGGGACACGCGGGCCTCGC
GCTGATCGTGCAGAGCGTGCTGGGCCACGATCCCTACAACGGCGCGATCTACCTGTTCCGCTCGAAGTGTGGCGACCAGT
TGAAGTGCCTGGTTTGGGATCAGACCGGCCTCGTTCTGATCTACAAGAAGCTCGAGGGCGGCGCCTTCCACTGGCCGAAG
CCGGCCGACGGGGTGATCCGGCTGTCGCCGGCGCAGTTCTCGGCTCTTGTCGAAGGGCTGGACTGGCGAGCGGTCCGGGC
CGAGCGGCGGCCGCGGCCAAGGCTGGCGGGATAG

Protein sequence :
MILPGGINRAYLATRPVDFRKGHAGLALIVQSVLGHDPYNGAIYLFRSKCGDQLKCLVWDQTGLVLIYKKLEGGAFHWPK
PADGVIRLSPAQFSALVEGLDWRAVRAERRPRPRLAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-18 48
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-16 47
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-16 47
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-15 47
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-14 44
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-14 44
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-14 43
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-14 43
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-14 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-14 43
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-14 43
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-14 43
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-14 43
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-14 43
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-14 43
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-13 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-13 42
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 7e-10 41
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-13 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-13 41
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-14 41
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-14 41
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG1665 Protein 6e-16 47
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG1698 Protein 1e-14 44
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG0792 Protein 2e-14 43
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG1052 Protein 3e-14 43
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG1709 Protein 2e-14 43
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG1517 Protein 3e-10 41
Rsph17025_4304 YP_001170454.1 hypothetical protein VFG1737 Protein 1e-14 41