Gene Information

Name : Ent638_4255 (Ent638_4255)
Accession : YP_001165534.1
Strain :
Genome accession: NC_009425
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional repressor ArsR
Function : -
COG functional category : K : Transcription
COG ID : COG0640
EC number : -
Position : 85128 - 85448 bp
Length : 321 bp
Strand : +
Note : regulates the expression of of the arsRBC involved in resistance to arsenic

DNA sequence : 
ATGCTACATCCTGTTCAGCTTTTCAAAATCCTGTCTGATGAAACACGGCTCGCCATCGTCATGATTCTGCGGGAGTCAGG
AGAAATGTGCGTGTGCGATATCTGTACAGCCACCTCCGAATCGCAGCCCAAAATCTCACGACATATGGCTATCCTTCGTG
AAGCTGAGCTGGTTATTGACCGTCGGGAAGGCAAATGGATCCACTACCGTCTGTCACCCCACATACCGGCGTGGGCAGCT
GAGATAATCGCAACGTCCTGGCAGTGTCTGCGAGAGGATGTGCGTGAATGGCTGCAAAAAGCAGCCTGCACCTCCTGCTG
A

Protein sequence : 
MLHPVQLFKILSDETRLAIVMILRESGEMCVCDICTATSESQPKISRHMAILREAELVIDRREGKWIHYRLSPHIPAWAA
EIIATSWQCLREDVREWLQKAACTSC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsR2 YP_001007630.1 DNA-binding transcriptional repressor ArsR Not tested YAPI Protein 5e-30 60
arsR AFC76435.1 ArsR Not tested AbaR5 Protein 1e-17 47
arsR CAJ77018.1 arsenite inducible repressor Not tested AbaR1 Protein 7e-18 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ent638_4255 YP_001165534.1 DNA-binding transcriptional repressor ArsR BAC0588 Protein 3e-35 89
Ent638_4255 YP_001165534.1 DNA-binding transcriptional repressor ArsR BAC0594 Protein 1e-30 62
Ent638_4255 YP_001165534.1 DNA-binding transcriptional repressor ArsR BAC0591 Protein 6e-30 61
Ent638_4255 YP_001165534.1 DNA-binding transcriptional repressor ArsR BAC0589 Protein 4e-30 60