Gene Information

Name : Strop_1197 (Strop_1197)
Accession : YP_001158045.1
Strain : Salinispora tropica CNB-440
Genome accession: NC_009380
Putative virulence/resistance : Virulence
Product : response regulator receiver
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1349136 - 1349828 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
GTGACGCAACGGGTGCTGGTCGTGGACGACGACCGAACAGTCAGTGATGTGGTCTGTCGCTACCTGGTACACGCCGGCTA
CCAGGTGCGGCACGTCGGCGACGGCGACTCGGCGCTCGCCGCGGTCGCTGCCGAACCGCCGGACCTCGTCGTGCTGGATC
TGATGCTGCCCGGGCTCGACGGCCTGGAGGTGTGCCGGCGGCTGCGGACCAAGCCGGGTGGGGTGCCCATCATCATGCTC
ACCGCACGCGGCGACGAGGCCGATCGCGTCCTCGGCCTCCAGCTGGGTGCCGATGACTATCTCAGCAAACCGTTCTCGCC
CCGGGAACTCGTGCTACGGGTCGGGTCGGTGCTGCGGCGCAGCGGTGAGCCCCGGACGGCACCGGCCACCGTGCTCCGCG
ACGGTGCGCTCGTGGTCGAGACAGGCCCTCGGGTGGCCCGGCTGCACGGCCACGAACTCACCCTCACCGTACGTGAGTTC
GACCTGCTGGCGTACCTGATGCGACACCCCGCGCGGGCGTTGGGCCGGGCCGAGTTGCTGGAGCGGGTGTGGGGCTGGAA
CTTCGGCGACCAGTCGACGGTGACTGTCCATGTCCGACGGCTACGGGAGAAGGTGGAGGCCGATCCCGCCAACCCGCACC
GGATCGTGACGGTCTGGGGCATCGGCTACCGGTACGAGCCGACCGATGGGTGA

Protein sequence :
MTQRVLVVDDDRTVSDVVCRYLVHAGYQVRHVGDGDSALAAVAAEPPDLVVLDLMLPGLDGLEVCRRLRTKPGGVPIIML
TARGDEADRVLGLQLGADDYLSKPFSPRELVLRVGSVLRRSGEPRTAPATVLRDGALVVETGPRVARLHGHELTLTVREF
DLLAYLMRHPARALGRAELLERVWGWNFGDQSTVTVHVRRLREKVEADPANPHRIVTVWGIGYRYEPTDG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strop_1197 YP_001158045.1 response regulator receiver AE000516.2.gene3505. Protein 7e-29 48
Strop_1197 YP_001158045.1 response regulator receiver NC_002952.2859905.p0 Protein 1e-34 47
Strop_1197 YP_001158045.1 response regulator receiver NC_002758.1121668.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_009641.5332272.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_013450.8614421.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_007622.3794472.p0 Protein 1e-34 47
Strop_1197 YP_001158045.1 response regulator receiver NC_007793.3914279.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_002745.1124361.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_009782.5559369.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_002951.3237708.p0 Protein 8e-35 47
Strop_1197 YP_001158045.1 response regulator receiver NC_012469.1.7686381. Protein 5e-38 47
Strop_1197 YP_001158045.1 response regulator receiver NC_012469.1.7685629. Protein 7e-33 47
Strop_1197 YP_001158045.1 response regulator receiver NC_003923.1003749.p0 Protein 9e-35 46
Strop_1197 YP_001158045.1 response regulator receiver BAC0197 Protein 2e-22 46
Strop_1197 YP_001158045.1 response regulator receiver BAC0125 Protein 3e-20 43
Strop_1197 YP_001158045.1 response regulator receiver HE999704.1.gene1528. Protein 3e-20 43
Strop_1197 YP_001158045.1 response regulator receiver CP000034.1.gene3671. Protein 6e-34 42
Strop_1197 YP_001158045.1 response regulator receiver HE999704.1.gene2815. Protein 5e-32 42
Strop_1197 YP_001158045.1 response regulator receiver CP000647.1.gene2531. Protein 5e-24 42
Strop_1197 YP_001158045.1 response regulator receiver BAC0083 Protein 8e-24 42
Strop_1197 YP_001158045.1 response regulator receiver DQ212986.1.gene4.p01 Protein 2e-27 41
Strop_1197 YP_001158045.1 response regulator receiver AF162694.1.orf4.gene Protein 6e-27 41
Strop_1197 YP_001158045.1 response regulator receiver CP001918.1.gene3444. Protein 9e-24 41
Strop_1197 YP_001158045.1 response regulator receiver BAC0039 Protein 2e-24 41
Strop_1197 YP_001158045.1 response regulator receiver CP000034.1.gene2186. Protein 2e-24 41
Strop_1197 YP_001158045.1 response regulator receiver NC_002695.1.916589.p Protein 2e-24 41
Strop_1197 YP_001158045.1 response regulator receiver BAC0111 Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Strop_1197 YP_001158045.1 response regulator receiver VFG1389 Protein 6e-28 44
Strop_1197 YP_001158045.1 response regulator receiver VFG1390 Protein 9e-27 43
Strop_1197 YP_001158045.1 response regulator receiver VFG1563 Protein 2e-32 42
Strop_1197 YP_001158045.1 response regulator receiver VFG1702 Protein 7e-32 42