|
Name : rpmJ (ASA_2375) Accession : YP_001142171.1 Strain : Aeromonas salmonicida A449 Genome accession: NC_009348 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0257 EC number : - Position : 2529856 - 2529981 bp Length : 126 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAAGTGCTCTCCTCCCTCAAATCAGCCAAGTCCCGCCACCCGGATTGCCAGATTGTCCGCCGCCGCGGCAAGCTGTT CGTGATCTGCAAGAGCAATCCCAGATTCAAGGCTCGCCAGCGCTGA Protein sequence : MKVLSSLKSAKSRHPDCQIVRRRGKLFVICKSNPRFKARQR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 2e-05 | 60 |
