Gene Information

Name : Mflv_1887 (Mflv_1887)
Accession : YP_001133155.1
Strain : Mycobacterium gilvum PYR-GCK
Genome accession: NC_009338
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1966913 - 1967608 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mpa:MAP0916 two-component response regulator

DNA sequence :
GTGCCAGTGCGCATACTTGTCGTTGATGACGATCGCGCCGTGCGCGAATCCCTGCGTCGGTCACTCTCCTTCAACGGATA
CTCGGTCGAACTCGCCCAGGACGGTCGGGAGGCCCTCGACCTGATCGCGTCCGACCGCCCCGACGCGGTGGTGCTCGACG
TGATGATGCCGAGGCTGGACGGACTCGAGGTCTGCCGACAGCTGCGGAGCACCGGCGACGACCTTCCCATCCTCGTTCTG
ACCGCCCGCGACTCGGTGTCCGAACGGGTCGCCGGCCTCGACGCCGGCGCCGACGACTACCTGCCGAAGCCGTTCGCGCT
GGAAGAGTTGCTGGCCCGGATGCGCGCTCTTCTGCGCCGCACCTCACCGGTCGACGGCGACGGCGAGTCGGCGGCGATGA
CGTTCTCCGATCTGACGTTGGACCCCGTGACCCGGGAAGTGACCCGCGGCAACCGCTCGATCAGCCTCACCCGCACCGAG
TTCTCACTGCTGGAGATGCTGATCACCAACCCCCGGCGCGTGCTGACCCGCAGCCGCATCCTGGAGGAGGTGTGGGGCTT
CGACTTCCCGACCTCCGGTAACGCGCTCGAGGTCTATGTCGGGTATCTGCGCCGCAAGACCGAGGCCGAAGGTGAACCGC
GGTTGATCCACACCGTGCGCGGCGTGGGCTACGTCCTCCGCGAGACGCCGCCCTGA

Protein sequence :
MPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAVVLDVMMPRLDGLEVCRQLRSTGDDLPILVL
TARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTSPVDGDGESAAMTFSDLTLDPVTREVTRGNRSISLTRTE
FSLLEMLITNPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-33 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_1887 YP_001133155.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-40 44
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0083 Protein 1e-33 44
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0308 Protein 3e-34 44
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0347 Protein 2e-30 43
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0111 Protein 6e-36 43
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0638 Protein 2e-28 43
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0125 Protein 2e-33 42
Mflv_1887 YP_001133155.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 42
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_012469.1.7686381. Protein 6e-36 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator BAC0197 Protein 8e-29 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-35 41
Mflv_1887 YP_001133155.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_1887 YP_001133155.1 two component transcriptional regulator VFG1390 Protein 5e-86 92
Mflv_1887 YP_001133155.1 two component transcriptional regulator VFG1386 Protein 4e-45 50
Mflv_1887 YP_001133155.1 two component transcriptional regulator VFG1389 Protein 1e-41 50
Mflv_1887 YP_001133155.1 two component transcriptional regulator VFG0596 Protein 2e-33 42