Gene Information

Name : Mflv_1744 (Mflv_1744)
Accession : YP_001133012.1
Strain : Mycobacterium gilvum PYR-GCK
Genome accession: NC_009338
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1811380 - 1812075 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_4448 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACAGTGGCTCACCCCGGGTGCTCGTGGTCGATGACGATCCCGACGTCCTGGCCTCGCTCGAGCGCGGGCTGCGACT
GTCCGGTTTCGACGTCTTCACCGCGGTCGACGGCGCCGAGGCGCTGCGCAGCGCCACCGAGACCCGGCCCGACGCGATCG
TCCTCGACATCAACATGCCCGTGCTCGACGGTGTGTCGGTCGTGACCGCGCTGCGCGCGATGGACAACGACGTGCCCGTC
TGCGTGCTGTCGGCGAGGTCGTCGGTGGACGACCGGGTGGCCGGCCTGGAGGCGGGCGCCGACGACTACCTGGTCAAGCC
GTTCGTGCTGGCCGAACTGGTCGCGCGGGTCAAGGCGCTGCTGCGGCGCCGCGGCTCTACGGCCACATTCTCGTCGGAGA
CCATCACCGTCGGGCCGCTCGAAGTCGACATCCCGGGTCGGCGCGCCCGCGTCGACGGGGTGGACGTCGACCTGACCAAG
CGCGAGTTCGATCTGCTCGCGGTCCTGGCCGAGCACAAGACCGCGGTGCTCTCCCGCGCACAGCTGCTCGAGTTGGTGTG
GGGCTACGACTTCGCCGCCGACACCAACGTCGTCGACGTCTTCATCGGCTACCTGCGCCGCAAGCTCGAAGCCAACGGCG
CTCCGAGGCTGCTGCATACGGTGCGCGGCGTGGGATTCGTCCTGCGGCAGCAGTAG

Protein sequence :
MDSGSPRVLVVDDDPDVLASLERGLRLSGFDVFTAVDGAEALRSATETRPDAIVLDINMPVLDGVSVVTALRAMDNDVPV
CVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGSTATFSSETITVGPLEVDIPGRRARVDGVDVDLTK
REFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEANGAPRLLHTVRGVGFVLRQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-25 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_1744 YP_001133012.1 two component transcriptional regulator BAC0083 Protein 1e-30 46
Mflv_1744 YP_001133012.1 two component transcriptional regulator BAC0125 Protein 3e-29 45
Mflv_1744 YP_001133012.1 two component transcriptional regulator BAC0197 Protein 1e-23 44
Mflv_1744 YP_001133012.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-28 44
Mflv_1744 YP_001133012.1 two component transcriptional regulator BAC0308 Protein 6e-27 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator HE999704.1.gene1528. Protein 9e-30 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-28 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator BAC0638 Protein 3e-23 42
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-31 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator BAC0111 Protein 2e-25 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator CP004022.1.gene3215. Protein 8e-18 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-26 41
Mflv_1744 YP_001133012.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mflv_1744 YP_001133012.1 two component transcriptional regulator VFG1389 Protein 1e-81 95
Mflv_1744 YP_001133012.1 two component transcriptional regulator VFG1390 Protein 9e-41 50
Mflv_1744 YP_001133012.1 two component transcriptional regulator VFG1386 Protein 4e-37 45
Mflv_1744 YP_001133012.1 two component transcriptional regulator VFG0596 Protein 2e-25 42