Gene Information

Name : GTNG_0792 (GTNG_0792)
Accession : YP_001124915.1
Strain : Geobacillus thermodenitrificans NG80-2
Genome accession: NC_009328
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 866076 - 866756 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence : 
ATGACAATGGCCCGAATTTTAGTTGTCGATGATGATGCACATATCCGCGAACTCGTCAGCCATTTTTTAAGTTTGGAAGG
ATTGACAATCCACGAAGCAGCTAATGGAAAAGAAGCACTTGACGTGCTAGAAACGACGAAAGTGGATTTGGTCATTATGG
ATATTATGATGCCGGAAATGGATGGGTGGGAACTATGCCGTGAACTGCGCGACTATGACGATGTTCCCATTCTGATGTTG
ACCGCTAAAGGGGAAACGAGGGAAAAAGTGAAAGGATTTTCTCTTGGGGCAGACGACTATCTCGTCAAACCGTTTGACCC
CCTTGAACTTGTCGCCCGTGTCAAAGCATTGCTTAAACGGTATCGTATCGCCACCTCGCAAATCGTGCAAATTGGCCATT
TGTCGTTAAACCGCAAGACGTACGAATGCCGTTTGGGAGACGTGGAAGTCCCTTTGCCACCAAAAGAATTCGAACTGCTT
TTTCAACTGGCCAGCTATCCCGGTAAAACGTTCACGCGCGACGAATTGATTGAACAGATTTGGGGTTACGATTATGAAGG
AGATGAGCGAACCGTTGATGTTCATATCAAGCGGCTGCGTGAACGGTTCGCTCAGCCGAACGTTCCCTTTTTCATCCGCA
CGATTCGTGGACTCGGCTATCGGCTGGAGGCACGCCAATGA

Protein sequence : 
MTMARILVVDDDAHIRELVSHFLSLEGLTIHEAANGKEALDVLETTKVDLVIMDIMMPEMDGWELCRELRDYDDVPILML
TAKGETREKVKGFSLGADDYLVKPFDPLELVARVKALLKRYRIATSQIVQIGHLSLNRKTYECRLGDVEVPLPPKEFELL
FQLASYPGKTFTRDELIEQIWGYDYEGDERTVDVHIKRLRERFAQPNVPFFIRTIRGLGYRLEARQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-38 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_0792 YP_001124915.1 two-component response regulator NC_012469.1.7685629. Protein 5e-42 45
GTNG_0792 YP_001124915.1 two-component response regulator NC_012469.1.7686381. Protein 1e-38 44
GTNG_0792 YP_001124915.1 two-component response regulator HE999704.1.gene2815. Protein 5e-43 43
GTNG_0792 YP_001124915.1 two-component response regulator AE000516.2.gene3505. Protein 6e-36 43
GTNG_0792 YP_001124915.1 two-component response regulator AF310956.2.orf0.gene Protein 4e-38 42
GTNG_0792 YP_001124915.1 two-component response regulator AM180355.1.gene1830. Protein 6e-40 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-39 42
GTNG_0792 YP_001124915.1 two-component response regulator AE016830.1.gene2255. Protein 2e-36 41
GTNG_0792 YP_001124915.1 two-component response regulator U35369.1.gene1.p01 Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_0792 YP_001124915.1 two-component response regulator VFG1390 Protein 2e-36 41