Gene Information

Name : GTNG_2656 (GTNG_2656)
Accession : YP_001126746.1
Strain : Geobacillus thermodenitrificans NG80-2
Genome accession: NC_009328
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2764931 - 2765635 bp
Length : 705 bp
Strand : -
Note : -

DNA sequence :
ATGGGCAAAAAAATTTTAGTTGTCGATGACGAGCAGCCGATTGTGACTCTTTTGTCTTACAATTTGGAGAAAGCCGGTTT
TCAAGTCGTAGCCGCCTATGACGGCGAAGAGGCGCTGGAGAAAGTGGCGTTTGAGCAGCCGGCGCTGATCATTTTGGACT
TGATGCTGCCAAAGCTTGACGGTGTCGAAGTATGCAAACGGCTTCGCCAGCAGCAAATCATGACGCCGATTTTAATGTTG
ACGGCACGGGACGATGAATTTGACAAGGTGCTCGGCCTTGAGCTTGGCGCAGATGATTACATGACGAAACCGTTCAGCCC
TCGCGAAGTCGTTGCGCGTGTGAAGGCGATTTTGCGCCGCACGGATCTTGCTCAACCGGCCGCTGAACCGAGCGAACGAC
TTGTCATCGGCGATCTGGAGATTTTCCCAGAGCGTTACGAAGCGGCAGTCGGCGACAAGCCGCTTGAGCTGACGCCGAAA
GAATTTGAGTTGCTCCTTCACTTAGCGCGGCATAAAGGGCGGGTGTTGACGCGCGATCAACTCCTCAGCGCGGTATGGAA
CTACGATTTTGCCGGCGATACACGCATTGTCGATGTCCATATCAGCCATTTGCGCGAGAAAATTGAGGAAGATACGAAAA
AGCCAGTATACATTAAAACGGTGCGCGGTCTCGGCTATAAATTGGAGGAACCGAGGCGGGTATGA

Protein sequence :
MGKKILVVDDEQPIVTLLSYNLEKAGFQVVAAYDGEEALEKVAFEQPALIILDLMLPKLDGVEVCKRLRQQQIMTPILML
TARDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTDLAQPAAEPSERLVIGDLEIFPERYEAAVGDKPLELTPK
EFELLLHLARHKGRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLREKIEEDTKKPVYIKTVRGLGYKLEEPRRV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-41 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-41 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-35 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-34 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_2656 YP_001126746.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-75 66
GTNG_2656 YP_001126746.1 two-component response regulator HE999704.1.gene2815. Protein 8e-71 63
GTNG_2656 YP_001126746.1 two-component response regulator AE016830.1.gene1681. Protein 6e-63 56
GTNG_2656 YP_001126746.1 two-component response regulator NC_012469.1.7685629. Protein 2e-58 56
GTNG_2656 YP_001126746.1 two-component response regulator NC_012469.1.7686381. Protein 2e-61 54
GTNG_2656 YP_001126746.1 two-component response regulator AE000516.2.gene3505. Protein 4e-41 47
GTNG_2656 YP_001126746.1 two-component response regulator CP004022.1.gene3215. Protein 1e-39 47
GTNG_2656 YP_001126746.1 two-component response regulator BAC0197 Protein 8e-33 46
GTNG_2656 YP_001126746.1 two-component response regulator CP001138.1.gene4273. Protein 4e-36 46
GTNG_2656 YP_001126746.1 two-component response regulator AF155139.2.orf0.gene Protein 9e-44 45
GTNG_2656 YP_001126746.1 two-component response regulator BAC0533 Protein 1e-35 45
GTNG_2656 YP_001126746.1 two-component response regulator CP000034.1.gene3834. Protein 1e-35 45
GTNG_2656 YP_001126746.1 two-component response regulator CP000647.1.gene4257. Protein 1e-35 45
GTNG_2656 YP_001126746.1 two-component response regulator NC_002695.1.915041.p Protein 1e-35 45
GTNG_2656 YP_001126746.1 two-component response regulator CP001918.1.gene5135. Protein 1e-31 45
GTNG_2656 YP_001126746.1 two-component response regulator CP001485.1.gene721.p Protein 2e-37 44
GTNG_2656 YP_001126746.1 two-component response regulator BAC0083 Protein 5e-35 43
GTNG_2656 YP_001126746.1 two-component response regulator BAC0308 Protein 1e-30 43
GTNG_2656 YP_001126746.1 two-component response regulator EU250284.1.orf4.gene Protein 5e-41 43
GTNG_2656 YP_001126746.1 two-component response regulator AM180355.1.gene1830. Protein 4e-41 43
GTNG_2656 YP_001126746.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-41 43
GTNG_2656 YP_001126746.1 two-component response regulator BAC0125 Protein 4e-32 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_010400.5986590.p0 Protein 2e-36 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_002951.3238224.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_007793.3914065.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_002758.1121390.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_010079.5776364.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_002952.2859858.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_007622.3794948.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_003923.1003417.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_013450.8614146.p0 Protein 5e-41 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_005054.2598277.p0 Protein 6e-42 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_014475.1.orf0.gen Protein 6e-42 42
GTNG_2656 YP_001126746.1 two-component response regulator AF162694.1.orf4.gene Protein 8e-38 42
GTNG_2656 YP_001126746.1 two-component response regulator CP000034.1.gene3671. Protein 2e-38 42
GTNG_2656 YP_001126746.1 two-component response regulator BAC0596 Protein 3e-34 42
GTNG_2656 YP_001126746.1 two-component response regulator CP000034.1.gene2186. Protein 1e-34 42
GTNG_2656 YP_001126746.1 two-component response regulator NC_002695.1.916589.p Protein 8e-35 42
GTNG_2656 YP_001126746.1 two-component response regulator CP001138.1.gene2239. Protein 3e-34 42
GTNG_2656 YP_001126746.1 two-component response regulator BAC0039 Protein 1e-34 42
GTNG_2656 YP_001126746.1 two-component response regulator CP004022.1.gene1676. Protein 6e-34 42
GTNG_2656 YP_001126746.1 two-component response regulator AF310956.2.orf0.gene Protein 3e-35 41
GTNG_2656 YP_001126746.1 two-component response regulator AE016830.1.gene2255. Protein 9e-35 41
GTNG_2656 YP_001126746.1 two-component response regulator U35369.1.gene1.p01 Protein 9e-35 41
GTNG_2656 YP_001126746.1 two-component response regulator CP000675.2.gene1535. Protein 2e-37 41
GTNG_2656 YP_001126746.1 two-component response regulator NC_010410.6002989.p0 Protein 3e-36 41
GTNG_2656 YP_001126746.1 two-component response regulator NC_011595.7057856.p0 Protein 3e-36 41
GTNG_2656 YP_001126746.1 two-component response regulator CP000647.1.gene2531. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_2656 YP_001126746.1 two-component response regulator VFG1389 Protein 1e-35 48
GTNG_2656 YP_001126746.1 two-component response regulator VFG1386 Protein 3e-41 46
GTNG_2656 YP_001126746.1 two-component response regulator VFG1390 Protein 1e-38 43
GTNG_2656 YP_001126746.1 two-component response regulator VFG1563 Protein 2e-41 43
GTNG_2656 YP_001126746.1 two-component response regulator VFG1702 Protein 2e-41 43
GTNG_2656 YP_001126746.1 two-component response regulator VFG0596 Protein 2e-32 41