Gene Information

Name : GTNG_2092 (GTNG_2092)
Accession : YP_001126189.1
Strain : Geobacillus thermodenitrificans NG80-2
Genome accession: NC_009328
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2228719 - 2229393 bp
Length : 675 bp
Strand : -
Note : -

DNA sequence :
ATGAATGGACGGATTTTATTGGTCGAAGATGAAGCAGGGTTGGCTCGCTTTTTGGAACTTGACTTGATGCATGAAGGATT
CGATGTGCATGTATGCGGAGATGGGCGCGAAGGGCTTGAGCTCGCTCTCTCTGAACCGTGGGATCTCATTTTACTTGATG
TTATGCTGCCAAGCTTAAACGGCATGGAAGTCTGCCGGCGCATTCGGGCGGCGAAATCGACGCCAATCATCATGATCACG
GCGCGCGACAGCGTATTTGATCGCGTCATGGGGTTGGATAACGGAGCAGATGACTATATTGTCAAGCCGTTTGCGATTGA
AGAACTTCTCGCCCGCATCCGCGCTTTGTTTCGCCGCGTTCATCCTGAATCGGGCGGACAAGTGTTGACGTTTAAAGACT
TAGTCGTCGATATGCAGGCGCGTACGGTCAAAAAAGGGAATGCGTTTATCGAATTGACGAAACGTGAGTATGATTTGCTC
GTCGCCTTTATGCAAAATATCAATGTTGTGTTGACGCGTGATTTGCTACTTGAGAAAGTATGGGGATTTGACACTGAGGT
GGAGACGAATGTTGTGGACGTCTATGTCCGCTATTTACGGCAAAAGCTTGACGAACACAATAAAGAGCGGTACATCCAAA
CGGTGCGCGGCGCGGGATATGTGATGCGGCCATGA

Protein sequence :
MNGRILLVEDEAGLARFLELDLMHEGFDVHVCGDGREGLELALSEPWDLILLDVMLPSLNGMEVCRRIRAAKSTPIIMIT
ARDSVFDRVMGLDNGADDYIVKPFAIEELLARIRALFRRVHPESGGQVLTFKDLVVDMQARTVKKGNAFIELTKREYDLL
VAFMQNINVVLTRDLLLEKVWGFDTEVETNVVDVYVRYLRQKLDEHNKERYIQTVRGAGYVMRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-33 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_2092 YP_001126189.1 two-component response regulator HE999704.1.gene1528. Protein 3e-69 65
GTNG_2092 YP_001126189.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator AE015929.1.gene1106. Protein 2e-53 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-56 56
GTNG_2092 YP_001126189.1 two-component response regulator BAC0308 Protein 1e-39 45
GTNG_2092 YP_001126189.1 two-component response regulator BAC0125 Protein 1e-37 44
GTNG_2092 YP_001126189.1 two-component response regulator NC_012469.1.7686381. Protein 4e-44 44
GTNG_2092 YP_001126189.1 two-component response regulator AE000516.2.gene3505. Protein 2e-37 44
GTNG_2092 YP_001126189.1 two-component response regulator BAC0197 Protein 5e-35 43
GTNG_2092 YP_001126189.1 two-component response regulator NC_012469.1.7685629. Protein 1e-38 42
GTNG_2092 YP_001126189.1 two-component response regulator BAC0083 Protein 5e-39 42
GTNG_2092 YP_001126189.1 two-component response regulator BAC0111 Protein 5e-38 42
GTNG_2092 YP_001126189.1 two-component response regulator BAC0638 Protein 9e-37 42
GTNG_2092 YP_001126189.1 two-component response regulator CP001485.1.gene721.p Protein 8e-32 41
GTNG_2092 YP_001126189.1 two-component response regulator BAC0347 Protein 4e-34 41
GTNG_2092 YP_001126189.1 two-component response regulator AE016830.1.gene1681. Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_2092 YP_001126189.1 two-component response regulator VFG1390 Protein 2e-46 48
GTNG_2092 YP_001126189.1 two-component response regulator VFG1389 Protein 9e-39 44
GTNG_2092 YP_001126189.1 two-component response regulator VFG0596 Protein 2e-34 43
GTNG_2092 YP_001126189.1 two-component response regulator VFG1563 Protein 4e-35 42
GTNG_2092 YP_001126189.1 two-component response regulator VFG1702 Protein 1e-35 42