Gene Information

Name : GTNG_0183 (GTNG_0183)
Accession : YP_001124312.1
Strain : Geobacillus thermodenitrificans NG80-2
Genome accession: NC_009328
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 196252 - 196938 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGCCTCACACGTTATTATTAGTGGATGATGAAGAAAGAGTCCTTGAATTTATGGAGCCCTTTTTGCGACAGGAAGGATT
TGAAATTGTCACAGCCAAAACGGGAAAGGAAGCGCTGCAAAAAGCAAAAGAAACCAATCCATCCCTTGTGGTGCTTGATT
GGATGCTTCCTGAAATGAGCGGGATTGATGTGTGCCGCGAACTTCGTAAGACGAGCCATGTTGGAATCATCATGGTCACA
GCAAAGACAGAGGAAACTGACAAAATCATTGGCCTAGAGGTGGGAGCTGATGATTACATCACCAAACCTTTTTCCCTGAG
GGAACTGGCAGCCCGCATTCGCTCCGTATTGCGGCGAATCGAAGGGCAAGACAATCAGGAGGAACTGATGAAACGCGGCG
ACTTGACCATTTCTGAAGCGCAATGCCGCGTATGGAAACGAGGAAGCGAAATCTCCTTAACGCCGACCGAATTTAAGCTG
CTGCTCACTCTAGCGGCAAAGCCAGGTGTCGTATATAGCCGGCTGCAGCTGTTGCAAAGCATTTTTGAAGATGACCTTTT
CAACGATGAACGAACTGTCGATGCTCATATCAGCCGGCTTCGTAAAAAGATTGAAGATGATCCGTCCCGTCCAGTCTATA
TCCAAACTGTCTATGGATTCGGCTATCGGTTCGGTGAGCAGATATGA

Protein sequence :
MPHTLLLVDDEERVLEFMEPFLRQEGFEIVTAKTGKEALQKAKETNPSLVVLDWMLPEMSGIDVCRELRKTSHVGIIMVT
AKTEETDKIIGLEVGADDYITKPFSLRELAARIRSVLRRIEGQDNQEELMKRGDLTISEAQCRVWKRGSEISLTPTEFKL
LLTLAAKPGVVYSRLQLLQSIFEDDLFNDERTVDAHISRLRKKIEDDPSRPVYIQTVYGFGYRFGEQI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_0183 YP_001124312.1 response regulator NC_012469.1.7685629. Protein 8e-40 48
GTNG_0183 YP_001124312.1 response regulator HE999704.1.gene2815. Protein 8e-40 48
GTNG_0183 YP_001124312.1 response regulator AE000516.2.gene3505. Protein 3e-35 46
GTNG_0183 YP_001124312.1 response regulator NC_010410.6002989.p0 Protein 1e-39 44
GTNG_0183 YP_001124312.1 response regulator NC_010400.5986590.p0 Protein 2e-39 44
GTNG_0183 YP_001124312.1 response regulator NC_011595.7057856.p0 Protein 1e-39 44
GTNG_0183 YP_001124312.1 response regulator NC_002952.2859905.p0 Protein 4e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_009782.5559369.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_002951.3237708.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_002758.1121668.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_009641.5332272.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_013450.8614421.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_007793.3914279.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_007622.3794472.p0 Protein 4e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_002745.1124361.p0 Protein 5e-37 44
GTNG_0183 YP_001124312.1 response regulator NC_003923.1003749.p0 Protein 5e-37 43
GTNG_0183 YP_001124312.1 response regulator BAC0596 Protein 3e-39 43
GTNG_0183 YP_001124312.1 response regulator BAC0039 Protein 3e-40 43
GTNG_0183 YP_001124312.1 response regulator CP001918.1.gene3444. Protein 6e-40 43
GTNG_0183 YP_001124312.1 response regulator CP001138.1.gene2239. Protein 3e-39 43
GTNG_0183 YP_001124312.1 response regulator CP000034.1.gene2186. Protein 3e-40 43
GTNG_0183 YP_001124312.1 response regulator CP000647.1.gene2531. Protein 1e-40 43
GTNG_0183 YP_001124312.1 response regulator NC_002695.1.916589.p Protein 3e-40 43
GTNG_0183 YP_001124312.1 response regulator AE016830.1.gene1681. Protein 1e-36 42
GTNG_0183 YP_001124312.1 response regulator NC_012469.1.7686381. Protein 9e-36 42
GTNG_0183 YP_001124312.1 response regulator CP004022.1.gene1676. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GTNG_0183 YP_001124312.1 response regulator VFG1563 Protein 2e-33 42
GTNG_0183 YP_001124312.1 response regulator VFG1702 Protein 2e-33 41