Gene Information

Name : Bcep1808_2733 (Bcep1808_2733)
Accession : YP_001120559.1
Strain :
Genome accession: NC_009256
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3025008 - 3025670 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bch:Bcen2424_2618 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGCGCATTCTGCTTGTTGAAGACGACCGCATGATCGCCGACGGCGTGCGCAAGGCGCTGCGCGCCGACGGCTTCGCGGT
CGACTGGGTGCAGGACGGCGACGCGGCGCTCACGGCGCTCGGCGGCGAGACGTACGACCTGCTGCTGCTCGACCTGGGCC
TGCCCAAGCGCGACGGCATCGACGTGCTGCGCACGCTGCGCGCGCGCGGCCTGGCGCTGCCGGTGCTGATCGTCACCGCG
CGCGATGCGGTCGCCGATCGCGTGAAGGGCCTCGACGCGGGCGCCGACGACTACCTCGTCAAGCCGTTCGATCTCGACGA
ACTCGGCGCGCGCATGCGCGCGCTGATCCGCCGCCAGGCCGGCCGCAGCGAATCGCTGATTCGCCATGGCCCGCTCACGC
TCGATCCGGCGTCTCACCAGGTGACGCTCGACGGCGCGCCCGTCGCGCTGTCCGCGCGGGAATTCGCGCTGCTCGAGGCG
CTGCTCGTGCGGCCCGGCGCGGTGCTGTCGAAAAGCCAGCTCGAGGAGAAGATGTACGGCTGGGGCGAAGAGATCGGCAG
CAACACGGTCGAGGTCTACATCCATGCGTTGCGCAAGAAGCTCGGTTCGGACCTGATCCGCAACGTGCGCGGCCTCGGCT
ACATGGTCGTCAAGGAAAGCTGA

Protein sequence : 
MRILLVEDDRMIADGVRKALRADGFAVDWVQDGDAALTALGGETYDLLLLDLGLPKRDGIDVLRTLRARGLALPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGPLTLDPASHQVTLDGAPVALSAREFALLEA
LLVRPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-36 51
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator BAC0487 Protein 4e-35 47
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator BAC0197 Protein 8e-31 45
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator BAC0083 Protein 3e-29 44
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator BAC0638 Protein 2e-22 44
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-28 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator VFG0473 Protein 1e-37 48
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator VFG1390 Protein 7e-35 45
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator VFG0596 Protein 2e-26 42
Bcep1808_2733 YP_001120559.1 two component transcriptional regulator VFG1389 Protein 1e-27 42