Gene Information

Name : Bcep1808_4846 (Bcep1808_4846)
Accession : YP_001117268.1
Strain :
Genome accession: NC_009255
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1715975 - 1716670 bp
Length : 696 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_B1729 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGAAAGTCCTGATCGTCGAAGACGAACCGAAGGTCGTCGAATACCTGAAGAGCGGCCTGACCGAGGAAGGCTGGGTCGT
CGACACCGCGCTCGACGGCGAAGACGGCGCGTGGAAGGCCGTCGAGTTCGACTACGACGTGGTCGTGCTCGACGTGATGC
TGCCGAAGCTCGACGGCTTCGGCGTGCTGCGCGCGTTGCGCGGGCAGAAGCAGACGCCCGTGATCATGCTGACCGCCCGC
GACCGCGTCGACGATCGCGTGCGCGGGCTGCGCGGCGGCGCCGACGACTATCTGACCAAGCCGTTCTCGTTCCTCGAGCT
GATCGAACGGCTGCGCGCGCTCACGCGCCGCGCGCGCGTGCAGGAATCGACGCTGATCTCGATCGGCGATCTGCGCGTCG
ACCTGATCGGCCGCCGCGCGACGCGCGACGGCACGCGCCTGGACCTGACCGCCCAGGAATTCCAGCTGCTCGGCGTGCTC
GCGCGGCGCAGCGGCGACGTGCTGTCGAAGACGACCATCGCCGAGCTGGTGTGGGACGTGAACTTCGACAGCAACGCGAA
CGTCGTCGAGACGGCGATCAAGCGACTGCGCGCGAAGCTCGACGGCCCGTTCACGGACAAGCTGCTGCATACGATCCGCG
GCATGGGCTACGTGCTCGAGGCGCGCGACGGCGGCGACAGCGAGAGGCACGCATGA

Protein sequence :
MKVLIVEDEPKVVEYLKSGLTEEGWVVDTALDGEDGAWKAVEFDYDVVVLDVMLPKLDGFGVLRALRGQKQTPVIMLTAR
DRVDDRVRGLRGGADDYLTKPFSFLELIERLRALTRRARVQESTLISIGDLRVDLIGRRATRDGTRLDLTAQEFQLLGVL
ARRSGDVLSKTTIAELVWDVNFDSNANVVETAIKRLRAKLDGPFTDKLLHTIRGMGYVLEARDGGDSERHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-41 51
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-40 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0083 Protein 1e-47 58
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-52 57
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0197 Protein 2e-47 54
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0638 Protein 5e-39 54
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0111 Protein 1e-45 51
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0308 Protein 6e-45 50
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator BAC0347 Protein 2e-40 48
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 3e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-41 51
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator VFG1389 Protein 8e-31 47
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator VFG1386 Protein 4e-26 42
Bcep1808_4846 YP_001117268.1 two component heavy metal response transcriptional regulator VFG1390 Protein 6e-28 41