Gene Information

Name : Dred_0759 (Dred_0759)
Accession : YP_001112122.1
Strain : Desulfotomaculum reducens MI-1
Genome accession: NC_009253
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 813142 - 813813 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mta:Moth_1131 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGGTGCCAGGGTCTTGGTTATTGATGACGACCCTAAAATAACGGCCATGTTACAGAGGGCCTTAACCTATGAAGGATA
CAGGGTAGAGGTAGCTAACGATGGTTATAAGGGAATGAATATGGCAAAGGAAAACCCTCCAGAGCTATTGATACTGGATA
TTATGTTACCTGGTTTGGACGGTTGGGAGATTTGCCAGCGATTTAGAAAAGATAATTTCACCCCTATTTTAATCCTCAGT
GCCAGGGATGAAGTGGAAAGTAAGGTAAAAGGTCTTAATTTAGGAGCAGATGATTATTTAGGTAAACCCTTTGCATTGGA
AGAACTGCTGGCTCGTGTTCAGGCTTTGCTAAGGCGAAGGATAACTGCCAATAAAGTTATTCAATTTTCGGACCTGAAAA
TGGATCTAGAAGCCAGGGAAGTACGTAGAGCAGGAAATTTACTTACCCTTACATCCCGGGAGTTTGATTTGCTAGCTCAT
TTTATGCATCATCCGAATCAAGTATTAACTAGGGAGCAAATTATAGATCGAGTTTGGGGCTTGGACTTCACCGGAGGCTC
CAATGTTCTGGAAGTCTATATTAATATGCTGCGACAGAAGATCGAAGACTATGGGTCAAGGATTATACATACGGTACGGG
GAGTTGGCTATGTTCTGAAGGAGCAGGGATAA

Protein sequence :
MGARVLVIDDDPKITAMLQRALTYEGYRVEVANDGYKGMNMAKENPPELLILDIMLPGLDGWEICQRFRKDNFTPILILS
ARDEVESKVKGLNLGADDYLGKPFALEELLARVQALLRRRITANKVIQFSDLKMDLEAREVRRAGNLLTLTSREFDLLAH
FMHHPNQVLTREQIIDRVWGLDFTGGSNVLEVYINMLRQKIEDYGSRIIHTVRGVGYVLKEQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0638 Protein 8e-33 46
Dred_0759 YP_001112122.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-30 43
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-34 43
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0083 Protein 6e-39 43
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0125 Protein 6e-40 43
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0308 Protein 2e-36 42
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0197 Protein 2e-41 42
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-33 41
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0347 Protein 7e-35 41
Dred_0759 YP_001112122.1 two component transcriptional regulator BAC0111 Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_0759 YP_001112122.1 two component transcriptional regulator VFG1390 Protein 1e-44 48
Dred_0759 YP_001112122.1 two component transcriptional regulator VFG1389 Protein 3e-32 44
Dred_0759 YP_001112122.1 two component transcriptional regulator VFG1386 Protein 3e-40 43
Dred_0759 YP_001112122.1 two component transcriptional regulator VFG0596 Protein 1e-34 41