Gene Information

Name : Dred_0707 (Dred_0707)
Accession : YP_001112071.1
Strain : Desulfotomaculum reducens MI-1
Genome accession: NC_009253
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 761844 - 762542 bp
Length : 699 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: chy:CHY_2047 DNA-binding response regulator

DNA sequence :
ATGCCCAAAATTCTTGTGGTTGAAGATGAACAACCCATTCGCGAATTAATCAAGTATAACCTTGAGCGAGAAGGCTTTCA
AGTTATACAGGCGGCGAACGGAGATATTGCCCTAGACATGGCCAAAAGCGAAGTTCCCGATATTATTTTACTGGATATTA
TGTTGCCCGGGCAGGATGGACTGTCTGTATGCCGCTATCTTCATCAAGATGCTGCTACCCGTTCCATTCCTATTATTATG
CTTAGTGCCAGAGGTGAAGAGTTGGATAAGGTTTTAGGCCTGGAGATGGGGGCCGATGATTATATTACCAAGCCCTTTAG
CCCACGGGAACTCATTGCACGTATAAAGGCACGCCTAAGGCGACAAACTGTGGAAAATCAAGTTTTAGAAGATGCAGGTA
GAATTACGGTAGGTAAGCTGGTGATTGATCAAGACCGCTTTGTTGTTTCGTATAACGGGATTAAACAGGATCTTACACCA
AAGGAGTTTGAATTATTGCGGTATCTGGCTAGGAACCCGGGCAAGGTGTTTACCAGGGATTTTCTACTGGAGCAAATTTG
GGGCTATGATTTCTCTGGGGATTCAAGAACGGTGGATGTTCACATCCGCCACATAAGGCAGAAGCTAGAGCAACTTCCCG
ATGCACCTCAGTTTATTGAAACTGTACGTGGAGTAGGCTATCGGTTCAAGGAGGTATAG

Protein sequence :
MPKILVVEDEQPIRELIKYNLEREGFQVIQAANGDIALDMAKSEVPDIILLDIMLPGQDGLSVCRYLHQDAATRSIPIIM
LSARGEELDKVLGLEMGADDYITKPFSPRELIARIKARLRRQTVENQVLEDAGRITVGKLVIDQDRFVVSYNGIKQDLTP
KEFELLRYLARNPGKVFTRDFLLEQIWGYDFSGDSRTVDVHIRHIRQKLEQLPDAPQFIETVRGVGYRFKEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-44 46
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-45 46
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-50 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-55 52
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_012469.1.7686381. Protein 8e-51 51
Dred_0707 YP_001112071.1 two component transcriptional regulator HE999704.1.gene2815. Protein 8e-54 49
Dred_0707 YP_001112071.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-41 47
Dred_0707 YP_001112071.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-50 46
Dred_0707 YP_001112071.1 two component transcriptional regulator BAC0596 Protein 8e-41 45
Dred_0707 YP_001112071.1 two component transcriptional regulator CP000034.1.gene2186. Protein 8e-42 45
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002695.1.916589.p Protein 5e-42 45
Dred_0707 YP_001112071.1 two component transcriptional regulator CP001138.1.gene2239. Protein 8e-41 45
Dred_0707 YP_001112071.1 two component transcriptional regulator BAC0039 Protein 8e-42 45
Dred_0707 YP_001112071.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 44
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-40 44
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-40 44
Dred_0707 YP_001112071.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-40 44
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 43
Dred_0707 YP_001112071.1 two component transcriptional regulator NC_002695.1.915041.p Protein 7e-33 43
Dred_0707 YP_001112071.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-38 43
Dred_0707 YP_001112071.1 two component transcriptional regulator CP000034.1.gene3834. Protein 7e-33 43
Dred_0707 YP_001112071.1 two component transcriptional regulator CP000647.1.gene2531. Protein 9e-41 43
Dred_0707 YP_001112071.1 two component transcriptional regulator CP004022.1.gene1676. Protein 4e-37 42
Dred_0707 YP_001112071.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-36 41
Dred_0707 YP_001112071.1 two component transcriptional regulator BAC0533 Protein 6e-32 41
Dred_0707 YP_001112071.1 two component transcriptional regulator CP004022.1.gene3215. Protein 2e-36 41
Dred_0707 YP_001112071.1 two component transcriptional regulator CP000647.1.gene4257. Protein 6e-32 41
Dred_0707 YP_001112071.1 two component transcriptional regulator AM180355.1.gene1830. Protein 5e-36 41
Dred_0707 YP_001112071.1 two component transcriptional regulator CP000034.1.gene3671. Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_0707 YP_001112071.1 two component transcriptional regulator VFG1563 Protein 7e-45 46
Dred_0707 YP_001112071.1 two component transcriptional regulator VFG1702 Protein 1e-45 46
Dred_0707 YP_001112071.1 two component transcriptional regulator VFG1389 Protein 1e-31 44
Dred_0707 YP_001112071.1 two component transcriptional regulator VFG0596 Protein 1e-30 41