Gene Information

Name : Dred_0338 (Dred_0338)
Accession : YP_001111711.1
Strain : Desulfotomaculum reducens MI-1
Genome accession: NC_009253
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 351961 - 352539 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: bsu:BG12768 similar to tellurium resistance protein

DNA sequence :
TTGATATCTCTGGCAAAGGGTCAAAAGATTGATTTAACTAAAAGCAACCCTGGATTAAGCAAAATTCTTGTTGGTCTCGG
TTGGGACACCAATAAGTATGATGGTGGTCATGAATTTGATTTAGATGTTGTTGCTTTCCTGGTGAATGCCGAAGGCAAAG
CCACCGGGGACAGTGCCTTTATTTTTTACAATAATAAGCAAGATGCCAGTGGTTCCGTTATTCTCTCCGGTGATAACCGC
ACCGGCGAGGGTGATGGCGACGATGAATATATAAAGATTAACCTGTCTGGTGTGCCCGCAGAAGTTGATAAAATTGCTGT
TTGCATCAATATCCATGATGCGGCAACTCGCAGCCAAAACTTTGGACAAGTTTCCAATGCCTACGTTCGCGTGGTAAATG
ATGAAACAAATGAAGAACTTATGCGCTACGACCTGGGCGAAGATTACTCCATCGAAACGGGTCTTGTGGCCTGCGAAATC
TATCGTCATAATGGCGAATGGAAATTCAATGCAGTGGGAAGTGGTTTCCAAGGGGGACTGGCATCCCTGGCCGCAACCTA
TGGCTTAAACGCTGGCTAA

Protein sequence :
MISLAKGQKIDLTKSNPGLSKILVGLGWDTNKYDGGHEFDLDVVAFLVNAEGKATGDSAFIFYNNKQDASGSVILSGDNR
TGEGDGDDEYIKINLSGVPAEVDKIAVCINIHDAATRSQNFGQVSNAYVRVVNDETNEELMRYDLGEDYSIETGLVACEI
YRHNGEWKFNAVGSGFQGGLASLAATYGLNAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-51 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-51 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-50 58
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-51 58
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-44 51
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-44 51
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-44 51
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-45 50
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-22 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_0338 YP_001111711.1 stress protein BAC0389 Protein 6e-51 58
Dred_0338 YP_001111711.1 stress protein BAC0390 Protein 2e-48 53