Gene Information

Name : Dred_0336 (Dred_0336)
Accession : YP_001111709.1
Strain : Desulfotomaculum reducens MI-1
Genome accession: NC_009253
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 350740 - 351312 bp
Length : 573 bp
Strand : +
Note : PFAM: stress protein; KEGG: ctc:CTC02234 tellurium resistance protein terD

DNA sequence :
TTGGCTGTTAATTTGCAAAAAGGTCAAAAGGTTGACTTAACAAAAGGGAGATCTAACCTTTCAAAGGTGGTTGTTGGCCT
GGGATGGGATACTAACAAATTTGATGGCCCAGACTTTGATTTAGATGCGTCTGCTTTCCTGCTTGGCGAGAACGGCAAAT
GCGCTAGTGCCGATGACTTTGTTTTTTATAATAACTTAAAACATGTTAGCGGTTCTGTTATGCATATGGGAGATAACCTT
ACTGGTGATGGTGATGGTGACGATGAACAGATTACCATTGATTTAAGCAAAGTACCTGCCCATATTCATAAAATTGCTAT
TACCGTTACCATTCATATGGCCAAAGAACGTAACCAGAATTTCGGTCTGGTTTCCAATGCCTTTGTTCGTGTGGTAGACG
ATAGCAACGGTTCTGAGCTGCTACGCTATGATTTAAGTGAAGATTACAGCATCGAAACCGCCCTGGTATTTGCAGAACTC
TACCGTCACGGTTCCGAATGGAAATTTGCTGCAGTTGGTCAAGGCTTCAACGAAGGCTTGCAAGGATTGGTTAATCTATA
TGGTTTAGCCTAA

Protein sequence :
MAVNLQKGQKVDLTKGRSNLSKVVVGLGWDTNKFDGPDFDLDASAFLLGENGKCASADDFVFYNNLKHVSGSVMHMGDNL
TGDGDGDDEQITIDLSKVPAHIHKIAITVTIHMAKERNQNFGLVSNAFVRVVDDSNGSELLRYDLSEDYSIETALVFAEL
YRHGSEWKFAAVGQGFNEGLQGLVNLYGLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-52 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-44 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-44 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-44 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-47 56
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-47 56
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-46 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-43 52
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-23 41
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-20 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_0336 YP_001111709.1 stress protein BAC0390 Protein 2e-48 60
Dred_0336 YP_001111709.1 stress protein BAC0389 Protein 2e-46 56
Dred_0336 YP_001111709.1 stress protein BAC0392 Protein 4e-20 41