Gene Information

Name : Dred_1903 (Dred_1903)
Accession : YP_001113249.1
Strain : Desulfotomaculum reducens MI-1
Genome accession: NC_009253
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2091809 - 2092501 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bld:BLi02458 two-component response regulator involved in aerobic and anaerobic respiration; RBL00841

DNA sequence :
TTGCCCAAGCTGTTAATTGTTGATGATGAGGAGAAAATCAGAAATCTAATAAAGGTTTATTTGGTCAAGGAAGGCTTTGA
AGTAGACGAGTTGGACAACGGCAATCGGGTAGTAGATAGTATTAAAAGTTCTCACTTTGATATGGTCGTTCTGGATATAA
TGTTACCTGGTCCAGATGGTTTGTCCCTATGTAAGGAAATTAGAAAAATTTCCAACATCCCAATTATTATGTTAACTGCC
AAGGGAGATGAAATCGATCGGATTATTGGATTGGAGGTTGGGGCAGATGATTATATTGTTAAGCCCTTTAGCCCTAGAGA
ACTGGTAGCTAGGATCAATGCTATTTTAAGACGAGTAGCTGCACAGCCAATCATCCAAGAAGATCGTACAGCGATACTGA
GTTTCTCAGAATTGACCATTAATCCTGATAATCGAACCGTGGAGGTACGGGGAAGTGAAATTGCCTTAACCCCCAAGGAA
TTTGACTTACTTTATTTTATGGCCAAAACTCCGGGTCGTGCTTTTAGCCGTGAGAATTTATTAGAAAACGTTTGGGGTTA
TGACTTTTATGGCGATTTACGTACTGTTGATACTCATATAAATCGCCTGAGGGATAAACTCAATATGGAAGGGACAAAGC
AAGCCATTACAACGGTCTGGGGTGTGGGTTATAAATTTGAGGTAACTAAATGA

Protein sequence :
MPKLLIVDDEEKIRNLIKVYLVKEGFEVDELDNGNRVVDSIKSSHFDMVVLDIMLPGPDGLSLCKEIRKISNIPIIMLTA
KGDEIDRIIGLEVGADDYIVKPFSPRELVARINAILRRVAAQPIIQEDRTAILSFSELTINPDNRTVEVRGSEIALTPKE
FDLLYFMAKTPGRAFSRENLLENVWGYDFYGDLRTVDTHINRLRDKLNMEGTKQAITTVWGVGYKFEVTK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-43 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-42 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_1903 YP_001113249.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-46 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-46 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 47
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-45 46
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-45 46
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-48 46
Dred_1903 YP_001113249.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-47 45
Dred_1903 YP_001113249.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-47 45
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-43 45
Dred_1903 YP_001113249.1 two component transcriptional regulator BAC0039 Protein 2e-43 45
Dred_1903 YP_001113249.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-43 45
Dred_1903 YP_001113249.1 two component transcriptional regulator AM180355.1.gene1830. Protein 1e-42 44
Dred_1903 YP_001113249.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-47 44
Dred_1903 YP_001113249.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-41 44
Dred_1903 YP_001113249.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-42 44
Dred_1903 YP_001113249.1 two component transcriptional regulator BAC0596 Protein 6e-43 44
Dred_1903 YP_001113249.1 two component transcriptional regulator CP001138.1.gene2239. Protein 6e-43 44
Dred_1903 YP_001113249.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 9e-40 43
Dred_1903 YP_001113249.1 two component transcriptional regulator CP004022.1.gene1676. Protein 2e-40 43
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-44 43
Dred_1903 YP_001113249.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-41 42
Dred_1903 YP_001113249.1 two component transcriptional regulator CP000034.1.gene3671. Protein 6e-43 42
Dred_1903 YP_001113249.1 two component transcriptional regulator CP001918.1.gene5135. Protein 5e-27 42
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-39 41
Dred_1903 YP_001113249.1 two component transcriptional regulator CP000675.2.gene1535. Protein 6e-38 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-41 41
Dred_1903 YP_001113249.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-41 41
Dred_1903 YP_001113249.1 two component transcriptional regulator CP000647.1.gene4257. Protein 8e-31 41
Dred_1903 YP_001113249.1 two component transcriptional regulator CP004022.1.gene3215. Protein 2e-33 41
Dred_1903 YP_001113249.1 two component transcriptional regulator BAC0533 Protein 8e-31 41
Dred_1903 YP_001113249.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 7e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dred_1903 YP_001113249.1 two component transcriptional regulator VFG1563 Protein 4e-43 42
Dred_1903 YP_001113249.1 two component transcriptional regulator VFG1702 Protein 4e-43 42