Gene Information

Name : mtrA (SACE_6447)
Accession : YP_001108542.1
Strain : Saccharopolyspora erythraea NRRL 2338
Genome accession: NC_009142
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 7229528 - 7230214 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGTGGGGCATGAAGGCACGCGTGCTCGTGGTGGACGACGATCCGGCCCTGGCCGAAATGCTGACCATCGTGCTCCGAGG
CGAGGGTTTCGAGACCGCCGTCGTCAGTGACGGCACCAAGGCCATGCCTGCCCTGCGGGAACTCAAACCCGACCTGGTGC
TGCTCGACCTGATGCTGCCGGGCATGAACGGCATCGACGTCTGCAAGGCCATCCGCACCGAGTCCGTCGTGCCGATCGTG
ATGCTGACCGCCAAGAGCGACACCGTCGACGTCGTGCTGGGCCTCGAGTCCGGCGCCGACGACTACGTCGTCAAGCCGTT
CAAGCCGAAGGAGCTCGTCGCCCGGCTGCGCGCCCGCCTGCGCCGCACCGACGCCGAGCCCGCCGAGGTGCTCTCGATCG
GCGACCTGACCATCGACGTCCCCGGGCACGAGGTGACCCGCGACGGCCAGCCGATCGCGCTCACGCCGCTGGAGTTCGAC
CTGCTGGTTGCCCTGGCCCGCAAGCCGCGCCAGGTGTTCACCCGCGAGGTCCTGCTCGAGCAGGTCTGGGGCTACCGCCA
CGCGGCCGACACCCGGCTGGTCAACGTCCACGTCCAGCGCCTGCGCTCCAAGGTGGAGCGCGACCCGGAGCGGCCCGAGG
TGGTGCTCACGGTTCGCGGCGTCGGCTACAAGGCCGGCCCGCCGTGA

Protein sequence :
MWGMKARVLVVDDDPALAEMLTIVLRGEGFETAVVSDGTKAMPALRELKPDLVLLDLMLPGMNGIDVCKAIRTESVVPIV
MLTAKSDTVDVVLGLESGADDYVVKPFKPKELVARLRARLRRTDAEPAEVLSIGDLTIDVPGHEVTRDGQPIALTPLEFD
LLVALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRSKVERDPERPEVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_001108542.1 two-component response regulator AE000516.2.gene3505. Protein 1e-76 82
mtrA YP_001108542.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-38 46
mtrA YP_001108542.1 two-component response regulator BAC0125 Protein 3e-29 45
mtrA YP_001108542.1 two-component response regulator NC_012469.1.7685629. Protein 3e-34 45
mtrA YP_001108542.1 two-component response regulator NC_012469.1.7686381. Protein 1e-37 44
mtrA YP_001108542.1 two-component response regulator HE999704.1.gene2815. Protein 2e-34 44
mtrA YP_001108542.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-31 42
mtrA YP_001108542.1 two-component response regulator BAC0197 Protein 9e-26 42
mtrA YP_001108542.1 two-component response regulator AE015929.1.gene1106. Protein 1e-27 41
mtrA YP_001108542.1 two-component response regulator AE016830.1.gene1681. Protein 9e-39 41
mtrA YP_001108542.1 two-component response regulator CP000675.2.gene1535. Protein 3e-28 41
mtrA YP_001108542.1 two-component response regulator HE999704.1.gene1528. Protein 2e-30 41
mtrA YP_001108542.1 two-component response regulator CP000034.1.gene2186. Protein 1e-29 41
mtrA YP_001108542.1 two-component response regulator CP001138.1.gene2239. Protein 9e-30 41
mtrA YP_001108542.1 two-component response regulator CP001918.1.gene3444. Protein 6e-30 41
mtrA YP_001108542.1 two-component response regulator BAC0039 Protein 1e-29 41
mtrA YP_001108542.1 two-component response regulator BAC0596 Protein 9e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_001108542.1 two-component response regulator VFG1389 Protein 1e-25 44
mtrA YP_001108542.1 two-component response regulator VFG1390 Protein 4e-29 43
mtrA YP_001108542.1 two-component response regulator VFG1702 Protein 1e-32 41