Gene Information

Name : resD (SACE_3343)
Accession : YP_001105543.1
Strain : Saccharopolyspora erythraea NRRL 2338
Genome accession: NC_009142
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3695514 - 3696218 bp
Length : 705 bp
Strand : +
Note : -

DNA sequence :
ATGGTCATGGACGCGGAGGCGGCGGCGCGGGTGCTCGTCGTCGACGACGACACCTCGGTGCGCGACGTCGTGCGGCGCTA
CCTGCAACGGGCCGGTTACGCGGTGGAGCTGGCCGGTGACGGCGAGACCGCCCTGCGGTTGCACGCCGAGCGCAAGCCGG
ACCTGGTCGTGCTCGACCTGATGCTGCCCGGCGTCGGCGGGCTTGAGGTCTGCCGGCGGCTGCGGGAGCGCGGCGAGGTG
CCGGTGGTGATGCTCACCGCGCTGGGCGAGGAGTCCGACCGCGTGGTGGGCCTGGAACAGGGGGCCGACGACTACGTGGT
CAAGCCGTTCAGCCCGCGCGAGCTGGTGCTGCGGGTCGCCTCCATCCTGCGGCGGGCGCGGACCTCCCAGCCGGCCGAGG
GCGAGGTCCTCACCGACGGCGCGCTGCGGCTGGACCTCGACGCCAGGCGCGGCACGCTCGACGGCGGCGAGCTGGCGCTG
ACCGGCAGGGAGTTCGACCTGCTGGTCTTCCTGCTGCGCCATCCCGGTCGCGCGTTCTCCCGCGCCGAGCTGCTGGAGCA
GGTGTGGGGCTGGAGCTTCGGCGACCACTCCACCGTGACCGTCCACATGAGACGACTGCGGGAGAAGGTCGAACCCGACC
CCGCGCGCCCGGTGCGCATCAACACCGTGTGGGGCGTCGGCTACCGCTACGACCCGGTGAGGTGA

Protein sequence :
MVMDAEAAARVLVVDDDTSVRDVVRRYLQRAGYAVELAGDGETALRLHAERKPDLVVLDLMLPGVGGLEVCRRLRERGEV
PVVMLTALGEESDRVVGLEQGADDYVVKPFSPRELVLRVASILRRARTSQPAEGEVLTDGALRLDLDARRGTLDGGELAL
TGREFDLLVFLLRHPGRAFSRAELLEQVWGWSFGDHSTVTVHMRRLREKVEPDPARPVRINTVWGVGYRYDPVR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_001105543.1 two-component response regulator AE000516.2.gene3505. Protein 2e-38 48
resD YP_001105543.1 two-component response regulator NC_012469.1.7685629. Protein 3e-37 47
resD YP_001105543.1 two-component response regulator BAC0197 Protein 3e-29 46
resD YP_001105543.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-39 45
resD YP_001105543.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-39 45
resD YP_001105543.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-39 45
resD YP_001105543.1 two-component response regulator HE999704.1.gene2815. Protein 3e-42 44
resD YP_001105543.1 two-component response regulator CP000647.1.gene2531. Protein 2e-32 43
resD YP_001105543.1 two-component response regulator CP001918.1.gene3444. Protein 9e-33 43
resD YP_001105543.1 two-component response regulator BAC0125 Protein 2e-31 42
resD YP_001105543.1 two-component response regulator BAC0083 Protein 2e-28 42
resD YP_001105543.1 two-component response regulator NC_010400.5986590.p0 Protein 6e-38 42
resD YP_001105543.1 two-component response regulator NC_011595.7057856.p0 Protein 6e-38 42
resD YP_001105543.1 two-component response regulator NC_010410.6002989.p0 Protein 6e-38 42
resD YP_001105543.1 two-component response regulator BAC0111 Protein 8e-32 42
resD YP_001105543.1 two-component response regulator CP000034.1.gene3671. Protein 6e-38 42
resD YP_001105543.1 two-component response regulator CP001138.1.gene2239. Protein 3e-33 42
resD YP_001105543.1 two-component response regulator CP000034.1.gene2186. Protein 2e-33 42
resD YP_001105543.1 two-component response regulator NC_002695.1.916589.p Protein 2e-33 42
resD YP_001105543.1 two-component response regulator BAC0596 Protein 3e-33 42
resD YP_001105543.1 two-component response regulator BAC0039 Protein 2e-33 42
resD YP_001105543.1 two-component response regulator AF130997.1.orf0.gene Protein 2e-30 41
resD YP_001105543.1 two-component response regulator BAC0347 Protein 8e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_001105543.1 two-component response regulator VFG1702 Protein 3e-35 44
resD YP_001105543.1 two-component response regulator VFG1563 Protein 3e-35 43
resD YP_001105543.1 two-component response regulator VFG1390 Protein 6e-32 43
resD YP_001105543.1 two-component response regulator VFG1389 Protein 8e-33 43