Gene Information

Name : SACE_0101 (SACE_0101)
Accession : YP_001102380.1
Strain : Saccharopolyspora erythraea NRRL 2338
Genome accession: NC_009142
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 125201 - 125863 bp
Length : 663 bp
Strand : -
Note : -

DNA sequence :
TTGAGCAAGATCCTGATCGCCGAGGACGAGGCCCGGATCGCCGCCTTCATCGAGAAGGGCCTGCGCGCGAACGGCTTCAC
CACGACCGTCGTCGGCGACGGCGACACCGCGCTCGACTACGTGCTGACCGGGGACTTCGACCTGGTCGTGCTCGACCTCG
GCCTGCCGGGCAAGGACGGCTTCGCGGTGCTGCGGGCGTTGCGCGCCCAGCGCGTGACGGTGCCGGTGATCATCCTGACC
GCGCGGGACTCCGTTCACGACACGGTCGCCGGCCTCGAAGGCGGCGCGGACGACTACATGACCAAGCCGTTCCGCTTCGA
GGAGCTGCTGGCGCGGGTGCGGCTGCGGTTGCGGCCCACCGACCGGGCTCCGGAGGTGACGGTGCTGCGCGACGGCGAGC
TGTCGCTGGACCTGCGCACCCGGCGCGCCCAGGTGCCCGAGGGAACCGTCGACCTGACGGCACGGGAGTTCTCGATGCTG
GAGCTGTTCCTGCGCCACTCCGGTCAGGTGCTCTCGCGCGAGCAGATCCTCTCCCACGTCTGGGGCTACGACTTCGACCC
CGGCTCGAATGTCGTGGACGTCTACGTGCGGGCGCTGCGGCGCAAGATTGGCAGCACACGCATCCACACCGTCCGCGGCA
TGGGCTACCGCCTCGGCGTCTGA

Protein sequence :
MSKILIAEDEARIAAFIEKGLRANGFTTTVVGDGDTALDYVLTGDFDLVVLDLGLPGKDGFAVLRALRAQRVTVPVIILT
ARDSVHDTVAGLEGGADDYMTKPFRFEELLARVRLRLRPTDRAPEVTVLRDGELSLDLRTRRAQVPEGTVDLTAREFSML
ELFLRHSGQVLSREQILSHVWGYDFDPGSNVVDVYVRALRRKIGSTRIHTVRGMGYRLGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-23 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-22 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_0101 YP_001102380.1 two component system response regulator BAC0197 Protein 1e-28 50
SACE_0101 YP_001102380.1 two component system response regulator BAC0083 Protein 2e-30 47
SACE_0101 YP_001102380.1 two component system response regulator BAC0638 Protein 3e-23 47
SACE_0101 YP_001102380.1 two component system response regulator BAC0125 Protein 2e-27 45
SACE_0101 YP_001102380.1 two component system response regulator AE015929.1.gene1106. Protein 7e-20 44
SACE_0101 YP_001102380.1 two component system response regulator BAC0308 Protein 2e-25 43
SACE_0101 YP_001102380.1 two component system response regulator HE999704.1.gene1528. Protein 2e-23 43
SACE_0101 YP_001102380.1 two component system response regulator NC_013450.8614146.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_002951.3238224.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_007793.3914065.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_002758.1121390.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_010079.5776364.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_002952.2859858.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_007622.3794948.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator NC_003923.1003417.p0 Protein 7e-24 42
SACE_0101 YP_001102380.1 two component system response regulator BAC0347 Protein 8e-25 42
SACE_0101 YP_001102380.1 two component system response regulator BAC0111 Protein 3e-27 42
SACE_0101 YP_001102380.1 two component system response regulator NC_002516.2.879194.p Protein 1e-19 42
SACE_0101 YP_001102380.1 two component system response regulator AE000516.2.gene3505. Protein 4e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SACE_0101 YP_001102380.1 two component system response regulator VFG1389 Protein 5e-28 47
SACE_0101 YP_001102380.1 two component system response regulator VFG0596 Protein 2e-23 44
SACE_0101 YP_001102380.1 two component system response regulator VFG1390 Protein 7e-26 43
SACE_0101 YP_001102380.1 two component system response regulator VFG1386 Protein 4e-27 41