Name : merP (SNSL254_pSN254_0166) Accession : YP_001102038.1 Strain : Genome accession: NC_009140 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic component MerP Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 147114 - 147389 bp Length : 276 bp Strand : - Note : identified by match to protein family HMM PF00403; match to protein family HMM TIGR02052 DNA sequence : ATGAAAAAACTGTTTGCCTCTCTCGCCATCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTCACGCTGTC CGTACCGGGCATGACCTGCTCCGCTTGTCCGATCACCGTTAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCAAAGTTA ACGTGACCTTCGAGACACGCGAAGCGGTTGTCACCTTCGATGATGCCAAGACCAGCGTGCAGAAGCTGACCAAGGCCACC GAAGACGCGGGCTATCCGTCCAGCGTCAAGAAGTGA Protein sequence : MKKLFASLAIAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVNVTFETREAVVTFDDAKTSVQKLTKAT EDAGYPSSVKK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-22 | 87 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-22 | 87 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-22 | 87 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-22 | 87 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-22 | 87 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-22 | 87 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-21 | 81 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-21 | 81 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-21 | 81 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
merP | YP_001102038.1 | mercuric transport protein periplasmic component MerP | BAC0231 | Protein | 1e-26 | 100 |
merP | YP_001102038.1 | mercuric transport protein periplasmic component MerP | BAC0678 | Protein | 3e-24 | 95 |
merP | YP_001102038.1 | mercuric transport protein periplasmic component MerP | BAC0679 | Protein | 1e-23 | 94 |
merP | YP_001102038.1 | mercuric transport protein periplasmic component MerP | BAC0675 | Protein | 9e-20 | 77 |
merP | YP_001102038.1 | mercuric transport protein periplasmic component MerP | BAC0674 | Protein | 5e-15 | 60 |