Gene Information

Name : merP (SNSL254_pSN254_0166)
Accession : YP_001102038.1
Strain :
Genome accession: NC_009140
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component MerP
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 147114 - 147389 bp
Length : 276 bp
Strand : -
Note : identified by match to protein family HMM PF00403; match to protein family HMM TIGR02052

DNA sequence :
ATGAAAAAACTGTTTGCCTCTCTCGCCATCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTCACGCTGTC
CGTACCGGGCATGACCTGCTCCGCTTGTCCGATCACCGTTAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCAAAGTTA
ACGTGACCTTCGAGACACGCGAAGCGGTTGTCACCTTCGATGATGCCAAGACCAGCGTGCAGAAGCTGACCAAGGCCACC
GAAGACGCGGGCTATCCGTCCAGCGTCAAGAAGTGA

Protein sequence :
MKKLFASLAIAAVVAPVWAATQTVTLSVPGMTCSACPITVKKAISKVEGVSKVNVTFETREAVVTFDDAKTSVQKLTKAT
EDAGYPSSVKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-22 87
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-22 87
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-22 87
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-22 87
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-22 87
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-22 87
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-21 81
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-21 81
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-21 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_001102038.1 mercuric transport protein periplasmic component MerP BAC0231 Protein 1e-26 100
merP YP_001102038.1 mercuric transport protein periplasmic component MerP BAC0678 Protein 3e-24 95
merP YP_001102038.1 mercuric transport protein periplasmic component MerP BAC0679 Protein 1e-23 94
merP YP_001102038.1 mercuric transport protein periplasmic component MerP BAC0675 Protein 9e-20 77
merP YP_001102038.1 mercuric transport protein periplasmic component MerP BAC0674 Protein 5e-15 60