Gene Information

Name : copR (HEAR0538)
Accession : YP_001098874.1
Strain : Herminiimonas arsenicoxydans
Genome accession: NC_009138
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with CusS, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 541859 - 542482 bp
Length : 624 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11004187, 11399769, 11283292; Product type r : regulator

DNA sequence :
ATGGAAGCAGGTTTTATGGTCGATTTAGCCCGGAACGGTCTGGATGGTCACCATATGGCAATGAACGAACAGTACGATTT
GGTGTTACTTGACGTCATGCTTCCTGACGTTGATGGCTGGCGCATCGTCAAATCGTTACGTGAAGCAGGCAAACAGATGC
CAGTTTTGTTTTTAACCGCACGTGGTGGTGTCGATGATCGTGTCAAAGGTCTTGAGTTAGGGGCCGACGATTACTTAATC
AAACCGTTCGCGTTTTCTGAATTATTAGCGAGAGTACGGACCTTGCTGCGGCGTGGTAGCGCTCCTAGCCAATCGGAAAG
ATTGGAAGTAGCTGATCTGATCCTGGATTTGCCGCGTCGCAAAGCAACCCGTATGGGTCAGAAAATAGTGCTGACCAACA
AAGAATTTTCCTTACTGGAGCTGTTGGCCAGAAGACAGGGGGAAGTGTTACCCCGTTCGCTGATCGCATCCCAAGTTTGG
GATATGAATTTCGATAGCGATAGTAACGCCATAGACGTGGCTATTCGCCGATTGCGCGCCAAGATTGACGATCCGTTTGA
GCCTAAACTCATTCATACGGTGCGCGGGATGGGCTACACACTAGATACGCCAAATGGCGAATAA

Protein sequence :
MEAGFMVDLARNGLDGHHMAMNEQYDLVLLDVMLPDVDGWRIVKSLREAGKQMPVLFLTARGGVDDRVKGLELGADDYLI
KPFAFSELLARVRTLLRRGSAPSQSERLEVADLILDLPRRKATRMGQKIVLTNKEFSLLELLARRQGEVLPRSLIASQVW
DMNFDSDSNAIDVAIRRLRAKIDDPFEPKLIHTVRGMGYTLDTPNGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-48 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-47 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0111 Protein 3e-64 69
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0083 Protein 7e-59 69
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0638 Protein 6e-51 66
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0347 Protein 5e-56 65
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0197 Protein 2e-54 64
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0308 Protein 7e-54 63
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0125 Protein 2e-52 62
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance HE999704.1.gene1528. Protein 4e-21 43
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0487 Protein 6e-23 43
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002516.2.879194.p Protein 5e-25 43
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance CP000034.1.gene3834. Protein 7e-21 42
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance CP001138.1.gene4273. Protein 2e-20 42
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002695.1.915041.p Protein 7e-21 42
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance CP001918.1.gene5135. Protein 3e-20 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance CP000647.1.gene4257. Protein 3e-20 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0533 Protein 3e-20 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_007622.3794472.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002745.1124361.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_009782.5559369.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002951.3237708.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_003923.1003749.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002758.1121668.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_009641.5332272.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_013450.8614421.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_007793.3914279.p0 Protein 2e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002952.2859905.p0 Protein 3e-25 41
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance CP004022.1.gene3215. Protein 3e-18 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG0596 Protein 6e-49 56
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1390 Protein 1e-34 45
copR YP_001098874.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1389 Protein 2e-32 44