Gene Information

Name : copR (HEAR1552)
Accession : YP_001099843.1
Strain : Herminiimonas arsenicoxydans
Genome accession: NC_009138
Putative virulence/resistance : Virulence
Product : response regulator in two-component regulatory system with CusS, regulation of copper resistance
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1542272 - 1542964 bp
Length : 693 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11004187, 11399769, 11283292; Product type r : regulator

DNA sequence :
ATGAAATTATTAATCGTCGAAGATGAAGTAAAGACTGGCGAATACCTACAGCAAGGGCTCATGGAAGCTGGTTTTGCAGT
GGATTACGCTAATAATGGGCTGGATGGGCATCATCTCGCCGTTACCGGAAACTATGACCTCATCATTCTGGATGTGATGC
TGCCAGATATAGACGGATGGAAAATTTTGCAAGCATTGCGTAATGCCGGCAACAATGTTCCAGCTCTTTTTTTAACCGCC
CGTGACGGTGTTGCAGATAGAGTGAAAGGTCTTGAACTGGGCGCTGATGACTACGTGGTCAAACCATTCGCGTTCTCAGA
ATTGCTGGCCCGAGTAAGAACATTACTACGTAGAGGAATTCCCAGCCCATTAGTGGATCGGATGCAAGTATCAGATTTAG
TCCTCGATCTTGCTCGACGAGCAGCTACTCGTGCGGGAAAACGACTAACCTTAACTAACAAGGAGTTCCTTCTGTTGGAA
TTCTTAGTGAGACACAAAGGCGAAGTTCTGCCTCGTTCCCTTATCGCCTCTCAAATTTGGGATATTAATTTTAATAGCGA
CACTAATGTTATTGATGTCGCTATTCGCCGCTTGCGCTCCAAAATGGATGACGATTACGAACCTAAATTAATCTCCACGA
TTCGGGGCGTCGGATATGTTCTTGAAGATCCAGATGATGCCAGGGTCGCATAA

Protein sequence :
MKLLIVEDEVKTGEYLQQGLMEAGFAVDYANNGLDGHHLAVTGNYDLIILDVMLPDIDGWKILQALRNAGNNVPALFLTA
RDGVADRVKGLELGADDYVVKPFAFSELLARVRTLLRRGIPSPLVDRMQVSDLVLDLARRAATRAGKRLTLTNKEFLLLE
FLVRHKGEVLPRSLIASQIWDINFNSDTNVIDVAIRRLRSKMDDDYEPKLISTIRGVGYVLEDPDDARVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-60 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-60 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0111 Protein 1e-75 69
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0083 Protein 2e-70 66
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0638 Protein 3e-64 65
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0197 Protein 1e-65 65
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0347 Protein 2e-68 63
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0308 Protein 7e-66 62
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0125 Protein 8e-62 58
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance BAC0487 Protein 4e-31 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_007622.3794948.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_003923.1003417.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_013450.8614146.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002951.3238224.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_007793.3914065.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002758.1121390.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_010079.5776364.p0 Protein 3e-34 41
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance NC_002952.2859858.p0 Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG0596 Protein 9e-61 56
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1390 Protein 3e-43 43
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1389 Protein 3e-35 43
copR YP_001099843.1 response regulator in two-component regulatory system with CusS, regulation of copper resistance VFG1386 Protein 7e-37 42