Gene Information

Name : Shew_3829 (Shew_3829)
Accession : YP_001095954.1
Strain : Shewanella loihica PV-4
Genome accession: NC_009092
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4560548 - 4560856 bp
Length : 309 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: vch:VCA0792 transposase OrfAB, subunit A

DNA sequence :
ATGAAGAACACAAGACCGACATTCAGTGCAGAGTTCAAGTTAGAAGCTGCACAACTGGTAACGAAACAGGGCTACAGCGT
TACTGAGGCAGCAAGCGCGATGGGCGTAAGTAATTCAGCCATGCGAAAGTGGGTTAACCAGCTTCGACAGGAGCAGCAAG
GCGTATCACCCAAAGGCGCACCGCTCACCCCCGAACAACAGCGGATCCGCGAGCTGGAGAAGAAAATCCGCCGCATTGAA
GAAGAGAACACCATTTTGAAAAAGGCTACGGCTCTCTTGATGTCAGACTCACTGAACAGTTCTCGTTAG

Protein sequence :
MKNTRPTFSAEFKLEAAQLVTKQGYSVTEAASAMGVSNSAMRKWVNQLRQEQQGVSPKGAPLTPEQQRIRELEKKIRRIE
EENTILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-22 71
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-22 71
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-22 71
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-22 71
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-22 71
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-22 71
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-22 71
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-22 71
l7045 CAD33744.1 - Not tested PAI I 536 Protein 4e-20 66
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 4e-20 66
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-17 65
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-19 64
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-21 62
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-21 62
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-20 61
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 8e-20 61
api80 CAF28554.1 putative transposase Not tested YAPI Protein 4e-15 61
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-19 61
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-19 61
unnamed AAC31483.1 L0004 Not tested LEE Protein 7e-20 61
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 5e-10 45
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 6e-09 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shew_3829 YP_001095954.1 transposase IS3/IS911 family protein VFG1123 Protein 2e-22 71
Shew_3829 YP_001095954.1 transposase IS3/IS911 family protein VFG1485 Protein 2e-20 66
Shew_3829 YP_001095954.1 transposase IS3/IS911 family protein VFG1553 Protein 6e-18 65
Shew_3829 YP_001095954.1 transposase IS3/IS911 family protein VFG0784 Protein 3e-20 61
Shew_3829 YP_001095954.1 transposase IS3/IS911 family protein VFG1566 Protein 2e-10 45
Shew_3829 YP_001095954.1 transposase IS3/IS911 family protein VFG1521 Protein 3e-09 43