Gene Information

Name : CD630_04860 (CD630_04860)
Accession : YP_001086960.1
Strain : Clostridium difficile 630
Genome accession: NC_009089
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 576313 - 576987 bp
Length : 675 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 18689481, 18790863; Product type r : regulator

DNA sequence :
ATGAACAATAAAATACTCGTCGTAGATGATGAGGAAGGTATAATAACACTCTTAAAAGATTACTTTGAAATGAATGGTTA
TGAGGTTTACACTGCTCAAAGTGGAAAAGACGCATTAAAAAAAATATCCAAAAATCCAGATATCATTCTACTTGATATAA
ACATGCCTGAAATAGATGGAATTGAAGTTTGTAATAGAATTAGAGATTATATATCATGCCCTATTCTATTTCTTACAGCT
AGAATTGAAAATACTGACAAGATAAATGGTTTTCGTGCTGGTGCTGATGATTATATTGTAAAACCTTTTGATTTAGACGA
ACTTGGAGCTAGAGTATCTGCCCATTTAAGACGTGAACAAAGGAAGTCAAATCAAACTAAAATTAAATTTTATAATGATT
TAACAATAGATTACGAAAAAAGGTTAATTTGTATATATAATAATCAGATTTCACTTTCAAAAAAGGAATTTGATATAGTA
GAGCTTCTCTCTATGAATCCTGGACAGGTATTTGATAAAGAAAAAATATATGATAGAGTCTGGGGATACAATAGCAATGG
AAATAGTGATGTTATAATGGAACACATTAGAAAAATACGAATCAAACTATCAAAACATACTCTTGAAAATTATATAGAAA
CAGTCTGGGGAGTTGGTTATAAATGGATAAAATAA

Protein sequence :
MNNKILVVDDEEGIITLLKDYFEMNGYEVYTAQSGKDALKKISKNPDIILLDINMPEIDGIEVCNRIRDYISCPILFLTA
RIENTDKINGFRAGADDYIVKPFDLDELGARVSAHLRREQRKSNQTKIKFYNDLTIDYEKRLICIYNNQISLSKKEFDIV
ELLSMNPGQVFDKEKIYDRVWGYNSNGNSDVIMEHIRKIRIKLSKHTLENYIETVWGVGYKWIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 4e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CD630_04860 YP_001086960.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-38 42
CD630_04860 YP_001086960.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-31 41
CD630_04860 YP_001086960.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-30 41
CD630_04860 YP_001086960.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-30 41
CD630_04860 YP_001086960.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-30 41
CD630_04860 YP_001086960.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-30 41
CD630_04860 YP_001086960.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-30 41
CD630_04860 YP_001086960.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-30 41
CD630_04860 YP_001086960.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-30 41