|
Name : CD630_03700 (CD630_03700) Accession : YP_001086837.1 Strain : Clostridium difficile 630 Genome accession: NC_009089 Putative virulence/resistance : Virulence Product : HTH-type transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG1476 EC number : - Position : 440311 - 440511 bp Length : 201 bp Strand : - Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 12568329, 12568327, 17650959, 11157942,11073898, 8863741,11839496, 11292341; Product type r : regulator DNA sequence : ATGATTAAGAACAGAATTAAAGAATTTAGGGCAAGATATGATATGAAACAAGACGACTTAGCGAAAGCAGTCGGTGTTCG ACGAGAAACGATTGGTAATCTTGAAAAAGGACGATACAATCCCTCTCTTGTATTAGCTTGGAATATTGCAAAAACATTTC ATGTAACGATTGAAGAAGTTTTTACAGTAATAGACGATTGA Protein sequence : MIKNRIKEFRARYDMKQDDLAKAVGVRRETIGNLEKGRYNPSLVLAWNIAKTFHVTIEEVFTVIDD |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SH2314 | YP_254229.1 | hypothetical protein | Not tested | ¥ðSh1 | Protein | 5e-10 | 41 |
| EF0524 | NP_814301.1 | Cro/CI family transcriptional regulator | Not tested | Not named | Protein | 2e-05 | 41 |
| ef0042 | AAM75247.1 | EF0042 | Virulence | Not named | Protein | 1e-05 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| CD630_03700 | YP_001086837.1 | HTH-type transcriptional regulator | VFG2168 | Protein | 6e-06 | 41 |
| CD630_03700 | YP_001086837.1 | HTH-type transcriptional regulator | VFG2175 | Protein | 6e-06 | 41 |
