Gene Information

Name : CD630_11261 (CD630_11261)
Accession : YP_001087617.1
Strain : Clostridium difficile 630
Genome accession: NC_009089
Putative virulence/resistance : Virulence
Product : HTH-type transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG1476
EC number : -
Position : 1325502 - 1325699 bp
Length : 198 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 11839496, 11292341; Product type r : regulator

DNA sequence :
GTGAAAAATAGATTAGAAGAAATAAGAAAAGAAAGAGGCATAAAACAAGAAGAACTTGCTTCTATTTTGCAAGTATCAAG
ACAAACTATAGGTTCATTAGAAAATGGTAGGTATAATCCTTCTATCATCTTAGCCTTTAAGATAGCTAGATACTTTGATA
TGAGTATTGAAGAAATATTTATTTATGAGGAGGAGTAA

Protein sequence :
MKNRLEEIRKERGIKQEELASILQVSRQTIGSLENGRYNPSIILAFKIARYFDMSIEEIFIYEEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH2314 YP_254229.1 hypothetical protein Not tested ¥ðSh1 Protein 8e-12 52
EF0524 NP_814301.1 Cro/CI family transcriptional regulator Not tested Not named Protein 1e-09 51
ef0042 AAM75247.1 EF0042 Virulence Not named Protein 8e-10 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CD630_11261 YP_001087617.1 HTH-type transcriptional regulator VFG2168 Protein 3e-10 51
CD630_11261 YP_001087617.1 HTH-type transcriptional regulator VFG2175 Protein 3e-10 51