Gene Information

Name : A1S_2908 (A1S_2908)
Accession : YP_001085916.1
Strain : Acinetobacter baumannii ATCC 17978
Genome accession: NC_009085
Putative virulence/resistance : Unknown
Product : integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 3369967 - 3371028 bp
Length : 1062 bp
Strand : -
Note : -

DNA sequence : 
ATGATTGCAGAAGGTGTGGACCCAAAAGAGCAACTTTCTATTCTTTTAGCAAAGAAAAATAATGTAAATACTTTAGAGAA
TGTAGTTAGAGTTTGGCTTGATGCTTATGCAGTTAGAAAACCTCTAAGTGAAGATACTAAAAATAAGCAATTAAGAAAAT
TTGAAAATCACTTATTTCCTAAGTTTAAAGATAAAGCAATTGAACAAATTACTCTTAGGGATTTAAAAGATGCTTTAAAT
GTAATTTATGACCATTCTCCTGATAATGCTCAAAGGATCAGAGCTTCATTGATCCAAGTTTATAGCTACGCTGTTCAGCA
TAGCTATATACAAACAAATATAGCTCGTGATTTAGAAGATATGGATTTGTCTGCTAGAAAGAACCATAGAGCGACTTTTA
GATCATTAGACCTAATTCCTCAACTGATACGGCGTATTAAGGCAGATAGTGGTAATCCCTTAACTAAGTTATGTTTATTA
TTGGGGTTGCATACTTTTCTTAGGTCATCAGAAATACGTTTTGCTAGGTGGAATGAAATCGACTTTGAAGCGGAAATATG
GAGAATTCCACCTCGTCGTCGATTAATTGAAGGTGTAAAACACTCTGATAGAGGTGCCAAGATGAAGGAAGAACACCTTG
TCCCATTATCCAAACAATCTATAGAAATACTAGAAAAAGTGTATCAGTACAGTGGTGACTGTGATTTTGTTTTTCCAAGT
CTAAATAATAAACGTATTTTTATTAGTGAAAATACGCCTAATGATGCCCTGCGCCGTATGGGGTATACAAAAGAGGAAAT
TAGTTTTCATGGCTTTAGGGCGCTAGCTCGATCTGCATTAGGTGAGATGTCAATATTTTCGAGAGATGCATTGGAGAAGC
AGATGAGTCATCAAGAGAGAAATGAGACAGTGGGGGCTTATACACATATTGCAGAGTATCTAGAGGAAAGAGAGAAAATT
ATGCAAATATGGAGTGATTGGTTGAGTGCTATAGAGAATGGAGATTATATAAGTCCGCATGAGTATGGGAGACATTTAAG
ACTTGGGGCTAGAGTTGGATAA

Protein sequence : 
MIAEGVDPKEQLSILLAKKNNVNTLENVVRVWLDAYAVRKPLSEDTKNKQLRKFENHLFPKFKDKAIEQITLRDLKDALN
VIYDHSPDNAQRIRASLIQVYSYAVQHSYIQTNIARDLEDMDLSARKNHRATFRSLDLIPQLIRRIKADSGNPLTKLCLL
LGLHTFLRSSEIRFARWNEIDFEAEIWRIPPRRRLIEGVKHSDRGAKMKEEHLVPLSKQSIEILEKVYQYSGDCDFVFPS
LNNKRIFISENTPNDALRRMGYTKEEISFHGFRALARSALGEMSIFSRDALEKQMSHQERNETVGAYTHIAEYLEEREKI
MQIWSDWLSAIENGDYISPHEYGRHLRLGARVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB ADN38968.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38960.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38952.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38969.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38961.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38953.1 P4-like integrase Not tested HPI Protein 2e-37 46
int ACR23136.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38962.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38954.1 P4-like integrase Not tested HPI Protein 2e-37 46
int ACR23139.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38963.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38955.1 P4-like integrase Not tested HPI Protein 2e-37 46
int ACR23141.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38964.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38956.1 P4-like integrase Not tested HPI Protein 2e-37 46
int ACR23142.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38965.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38957.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38947.1 P4-like integrase Not tested HPI Protein 2e-37 46
int ACR23145.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38966.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38958.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38948.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38967.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38959.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB ADN38951.1 P4-like integrase Not tested HPI Protein 2e-37 46
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 1e-50 42
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 3e-43 42
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 3e-43 42
int AAK00456.1 Int Not tested SHI-1 Protein 1e-45 41
int CAC81896.1 integrase Not tested LEE II Protein 3e-46 41
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 1e-46 41
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 4e-46 41
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 1e-45 41
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 1e-45 41
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 1e-45 41
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 3e-46 41
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 4e-46 41
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 4e-46 41
int AAK16198.1 Int Not tested PAI-I AL862 Protein 2e-46 41
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 2e-46 41
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 4e-46 41
int AAL51003.1 CP4-like integrase Not tested LEE Protein 3e-46 41
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 3e-46 41
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 4e-47 41
int AAL51028.1 CP4-like integrase Not tested LEE Protein 3e-46 41
int-phe AAL60261.1 Int-phe Not tested LEE Protein 3e-46 41
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 4e-46 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A1S_2908 YP_001085916.1 integrase VFG1536 Protein 6e-51 42
A1S_2908 YP_001085916.1 integrase VFG0626 Protein 6e-46 41
A1S_2908 YP_001085916.1 integrase VFG1693 Protein 2e-47 41