Gene Information

Name : Mjls_4523 (Mjls_4523)
Accession : YP_001072783.1
Strain : Mycobacterium sp. JLS
Genome accession: NC_009077
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4748268 - 4749023 bp
Length : 756 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_1439 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACTCCATGAGCAACACATCAGTGCCCTCGGGTGAGGATGCGCGAGGCTACCGGGCGCTCGTGGTCGATGACGAGGC
CGCGCTGGCTGAGGTGGTGGCCAGCTACCTGAATCGCGATCACTTCACCACCCGCATCGTCGACAACGGGCCCGATGCGG
TGGCCGTGGCCCGCGACTTCGACCCCGACGTGGTGATCCTCGATCTTGGGCTGCCCGGCATGGACGGGTTAGAGGTGTGC
CGCCGGCTGCGCACCTTCTCCGACGCCTACGTGGTCATGCTCACCGCCCGCGACACCGAAATGGACACCATCGTCGGACT
CACTGTCGGCGCCGACGATTACGTCACCAAACCCTTCAGCCCACGCGAACTAGTGGCACGCATCCGCGCGATGCTGCGAC
GCCCGCGCGCCACCCCCGAGCGCGAGAGCGACGGCGGCGGCGACGTAGCCGCCCCGCTGTCGTTTGGGCCGTTGCGTATC
GATGTGGCGGCGCGGGAAGTGTCCCTGGACGGTGAACCGATCCTGTTGACCCGCACCGAATTTGACCTACTCGCCGCCCT
GTCGGCGCGCCCGGGCGTGGTACTGAGCCGCCGCCAGTTGCTCGAGACCGTGCGCGAGGGGCCCTGGGTCGGCAACGAAC
ACCTCGTTGATGTCCATATCGGCCATGTGCGACGCAAACTCGGCGACGATCCGGCTGCACCTCGTTACGTCATCACCGTT
CGCGGCGTCGGATACCGCATGGGAGGCGGGCAGTGA

Protein sequence :
MNSMSNTSVPSGEDARGYRALVVDDEAALAEVVASYLNRDHFTTRIVDNGPDAVAVARDFDPDVVILDLGLPGMDGLEVC
RRLRTFSDAYVVMLTARDTEMDTIVGLTVGADDYVTKPFSPRELVARIRAMLRRPRATPERESDGGGDVAAPLSFGPLRI
DVAAREVSLDGEPILLTRTEFDLLAALSARPGVVLSRRQLLETVREGPWVGNEHLVDVHIGHVRRKLGDDPAAPRYVITV
RGVGYRMGGGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-28 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mjls_4523 YP_001072783.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-33 45
Mjls_4523 YP_001072783.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-33 43
Mjls_4523 YP_001072783.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-39 43
Mjls_4523 YP_001072783.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-36 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator CP000034.1.gene3671. Protein 2e-36 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-34 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator CP001918.1.gene3444. Protein 5e-34 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator BAC0039 Protein 2e-34 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-34 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator BAC0125 Protein 1e-21 41
Mjls_4523 YP_001072783.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-35 41
Mjls_4523 YP_001072783.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-34 41
Mjls_4523 YP_001072783.1 two component transcriptional regulator CP000647.1.gene2531. Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mjls_4523 YP_001072783.1 two component transcriptional regulator VFG1702 Protein 2e-28 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator VFG1563 Protein 2e-28 42
Mjls_4523 YP_001072783.1 two component transcriptional regulator VFG1386 Protein 3e-27 41