Gene Information

Name : Sbal_0726 (Sbal_0726)
Accession : YP_001049123.1
Strain : Shewanella baltica OS155
Genome accession: NC_009052
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 818770 - 819081 bp
Length : 312 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: sfr:Sfri_4014 transposase IS3/IS911 family protein

DNA sequence :
ATGAGATCGACAACCAGAAAAACATTTAGTGCTGAATTCAAACTTGAAGCAGCCCAATTAGTCCTCGATAAAAACCATAG
CATCATCGAAGCTGCAAAGGCGATGAACGTAGGTAAGTCCACTATGGATAAATGGGTGAGACAGTTAAAACTAGAACGCC
AGGGTGGCACACCAAAAGCATCTCCGATTACCCCTGAACAAATTGAAATCCGTGAGCTGAAGAAGCAAATAGCTCGTCTT
GAGGAGCACAATCTTATCCTAAAAAAGGCTACCGCTCTCTTGATGTCAGACTCGATGAACAATTTACGCTAA

Protein sequence :
MRSTTRKTFSAEFKLEAAQLVLDKNHSIIEAAKAMNVGKSTMDKWVRQLKLERQGGTPKASPITPEQIEIRELKKQIARL
EEHNLILKKATALLMSDSMNNLR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 83
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-32 83
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 83
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 83
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 83
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 83
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 83
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-32 83
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-26 68
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-26 68
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 2e-25 67
api80 CAF28554.1 putative transposase Not tested YAPI Protein 6e-22 66
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-23 63
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-27 63
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 7e-27 63
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-26 62
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-26 62
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 5e-26 62
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 5e-26 62
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 5e-21 56
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-16 48
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-16 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-12 46
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-11 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal_0726 YP_001049123.1 transposase IS3/IS911 family protein VFG1123 Protein 9e-33 83
Sbal_0726 YP_001049123.1 transposase IS3/IS911 family protein VFG1485 Protein 9e-27 68
Sbal_0726 YP_001049123.1 transposase IS3/IS911 family protein VFG1553 Protein 6e-24 63
Sbal_0726 YP_001049123.1 transposase IS3/IS911 family protein VFG0784 Protein 1e-26 62
Sbal_0726 YP_001049123.1 transposase IS3/IS911 family protein VFG1566 Protein 6e-13 46
Sbal_0726 YP_001049123.1 transposase IS3/IS911 family protein VFG1521 Protein 7e-12 44