Gene Information

Name : Sbal_0261 (Sbal_0261)
Accession : YP_001048664.1
Strain : Shewanella baltica OS155
Genome accession: NC_009052
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 296375 - 297061 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: shn:Shewana3_0253 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGAGTCGGATATTATTAATCGATGACGATCTGGGTTTATCGGAGCTACTAGGGCAACTGCTCGAGTTAGAAGGGTTTCA
ATTAACCTTGGCCTACGACGGTAAACAAGGTTTAGATCTGGCACTGAGTGCGGATTACGATCTGATCTTACTCGATGTCA
TGCTGCCTAAATTGAACGGCTTCGAAGTCCTGCGTGCACTGCGTCAGCACAAGCAAACGCCAGTATTAATGCTGACCGCC
CGCGGCGATGAAATCGATCGCGTAGTTGGGCTTGAAATCGGCGCCGATGATTATCTGCCAAAGCCGTTTAATGACAGAGA
ATTAATCGCCCGTATCCGCGCAATTATTCGTCGCTCGAACTTAACAACCCAAGAAATCCATGCCGCGCCCGCCCAAGAAT
TTGGCGATTTACGCTTAGACCCATCGCGCCAAGAGGCTTATTGTAACGAGCAGTTAATCATACTTACAGGCACAGAATTC
ACTCTGCTGCACACCCTCGCGCTGCACGCGGGAGAGTTGATGAATAAGGAAGAGTTAAACGAGAAAGTGCTCGGCAAAAA
ACTCATGCCCTTCGATCGCAGCTTAGACATGCATTTATCGAATCTACGTAAAAAACTCCCCGAGCGTGGCGATGGGCGGC
CAAGGGTGAAAACCATCCGCGGCAAAGGTTATATTTGGCTTCCATAA

Protein sequence : 
MSRILLIDDDLGLSELLGQLLELEGFQLTLAYDGKQGLDLALSADYDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTA
RGDEIDRVVGLEIGADDYLPKPFNDRELIARIRAIIRRSNLTTQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEF
TLLHTLALHAGELMNKEELNEKVLGKKLMPFDRSLDMHLSNLRKKLPERGDGRPRVKTIRGKGYIWLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-24 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP001138.1.gene4273. Protein 1e-43 62
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP001918.1.gene5135. Protein 3e-43 61
Sbal_0261 YP_001048664.1 two component transcriptional regulator BAC0533 Protein 5e-43 61
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP000034.1.gene3834. Protein 3e-43 61
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP000647.1.gene4257. Protein 5e-43 61
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_002695.1.915041.p Protein 3e-43 61
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP004022.1.gene3215. Protein 2e-46 60
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP001485.1.gene721.p Protein 3e-45 58
Sbal_0261 YP_001048664.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-37 54
Sbal_0261 YP_001048664.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-26 44
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-26 42
Sbal_0261 YP_001048664.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-22 41
Sbal_0261 YP_001048664.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-27 41
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-26 41
Sbal_0261 YP_001048664.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sbal_0261 YP_001048664.1 two component transcriptional regulator VFG1390 Protein 1e-21 41
Sbal_0261 YP_001048664.1 two component transcriptional regulator VFG0596 Protein 1e-24 41