Gene Information

Name : Rsph17029_3977 (Rsph17029_3977)
Accession : YP_001045827.1
Strain :
Genome accession: NC_009050
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1117926 - 1118600 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rsp:RSP_3241 two-component transcriptional regulator, winged helix family

DNA sequence :
ATGAAGATCCTGCTTGCCGAGGACGACCGCCAGACCGCCGACTACCTCCGCCAGGGTCTTCTGGCCGAGGGCTACAGCGT
GGATCATGTGCCCGACGGGCGCGATGCGCTGGTGCAGGCGACGCTGCAACCCTACGACCTCCTCGTGGTCGACCGGATGA
TGCCGGGGCTCGACGGGCTCTCGCTCGTCAAGGCACTGCGCTCGGCGCAGATCAAGGCGCCGATCCTGATCCTGACCGCC
ATGGGCGGCGTGACGGACAGGGTGGAGGGGCTGCAGGCCGGGGCCGACGATTATCTGGTCAAGCCCTTCGCCTTCTCGGA
ACTGTCGGCGCGGCTGGCGGCGCTGGCCCGCCGTCCCGCCCTCGCCGAGGGCGCGCGCGATCTGTTGCGGGTGGGCGATC
TCACGCTCGACACCGTGCGCCGCACCGTCAGCCGCGGCGGCACCGAGATCGACCTTCAGCCGCGCGAATTCCGGCTTCTC
GAACATCTGATGCGGGCCGCGGGGCGCGTGCAGACGCGCACGATGCTGCTCGAAGCGGTCTGGGATTTCCATTTCGATCC
CGGCACCAGCGTCGTCGAGACCCACATGAGCCGCCTGCGCGCCAAGATCGACCGGCCGTTCGACAAGCCGCTGCTCCACA
CGGTCCGGGGCGCGGGCTACATGCTGAAGGCATGA

Protein sequence :
MKILLAEDDRQTADYLRQGLLAEGYSVDHVPDGRDALVQATLQPYDLLVVDRMMPGLDGLSLVKALRSAQIKAPILILTA
MGGVTDRVEGLQAGADDYLVKPFAFSELSARLAALARRPALAEGARDLLRVGDLTLDTVRRTVSRGGTEIDLQPREFRLL
EHLMRAAGRVQTRTMLLEAVWDFHFDPGTSVVETHMSRLRAKIDRPFDKPLLHTVRGAGYMLKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-38 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0083 Protein 3e-44 52
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0638 Protein 4e-35 47
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0125 Protein 2e-39 46
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0111 Protein 2e-39 46
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0197 Protein 7e-38 46
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0347 Protein 4e-35 45
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator BAC0308 Protein 1e-39 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator VFG0596 Protein 6e-39 47
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator VFG1390 Protein 3e-34 46
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator VFG0473 Protein 2e-24 42
Rsph17029_3977 YP_001045827.1 two component transcriptional regulator VFG1389 Protein 7e-27 41