Gene Information

Name : Cthe_2333 (Cthe_2333)
Accession : YP_001038728.1
Strain : Clostridium thermocellum ATCC 27405
Genome accession: NC_009012
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2780172 - 2780870 bp
Length : 699 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulatory protein-like; KEGG: tte:TTE2689 response regulators consisting of a CheY-like receiver domain and a HTH DNA-binding domain

DNA sequence :
ATGAGCGCGAAAATCCTTGTTGTTGATGACGAGAAAAATATAGTTGACATTCTCAAATTTAATTTGGCAAAAGAGGGTTT
TTCCACGCTTGAAGCAAATGACGGCGAACAAGCTATTGAACTTGCGCTAAGTGAAAAGCCGGATTTGATACTGCTGGACA
TAATGCTTCCCAAATTGGACGGCTTTACCGTTTGCCGCAAATTGAGGGAAAGTATATCCACTCCCATTATAATGATTACT
GCAAAGGAAGAGGAAGTTGACAAGGTATTGGGATTGGAGCTTGGAGCGGATGATTATATAACAAAGCCTTTCAGCACGAG
GGAGCTGATGGCGAGAGTAAAAGCCAATTTAAGAAGGGTTGCTTCCTCTGCGGAGACTCAAAAGAAGCAAAGCAATTATT
TGAAATTCGGAGACTTGGAGATAGATATCGAACATTATGAAGTAAGAAGAAACAATGAGGTAATTGAGCTGACATTAAGG
GAATTTGAACTTGTAAAATTCCTGGCATTGCAGCCGGGCCAGATATTTTCAAGGGAGACCCTTTTGGAAAAGGTCTGGGG
TTATGAATATTACGGCGACGTCCGTACGGTGGATGTGACTGTAAGAAGAGTGAGGGAGAAGATTGAAAAGGATCCGAGCA
ATCCTTGCTACATTATGACCAAAAGAGGGGTAGGATATTATTTCAACAAATTAAGTTAA

Protein sequence :
MSAKILVVDDEKNIVDILKFNLAKEGFSTLEANDGEQAIELALSEKPDLILLDIMLPKLDGFTVCRKLRESISTPIIMIT
AKEEEVDKVLGLELGADDYITKPFSTRELMARVKANLRRVASSAETQKKQSNYLKFGDLEIDIEHYEVRRNNEVIELTLR
EFELVKFLALQPGQIFSRETLLEKVWGYEYYGDVRTVDVTVRRVREKIEKDPSNPCYIMTKRGVGYYFNKLS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR2 YP_006309922.1 NisR Not tested FWisland_1 Protein 3e-22 44
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-51 55
Cthe_2333 YP_001038728.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-50 54
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_012469.1.7686381. Protein 3e-46 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 49
Cthe_2333 YP_001038728.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-45 48
Cthe_2333 YP_001038728.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-40 48
Cthe_2333 YP_001038728.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-36 46
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP004022.1.gene3215. Protein 3e-31 46
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP001138.1.gene4273. Protein 2e-26 45
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-22 45
Cthe_2333 YP_001038728.1 two component transcriptional regulator BAC0533 Protein 1e-26 44
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002695.1.915041.p Protein 5e-26 44
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP000647.1.gene4257. Protein 1e-26 44
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP000034.1.gene3834. Protein 5e-26 44
Cthe_2333 YP_001038728.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-39 43
Cthe_2333 YP_001038728.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP000034.1.gene3671. Protein 5e-36 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator BAC0039 Protein 3e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator BAC0596 Protein 2e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP000034.1.gene2186. Protein 3e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-32 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP004022.1.gene1676. Protein 1e-28 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_011586.7046392.p0 Protein 2e-28 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_010410.6002907.p0 Protein 2e-28 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-28 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator BAC0197 Protein 6e-30 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-32 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-33 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-33 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-36 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-27 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_2333 YP_001038728.1 two component transcriptional regulator VFG1389 Protein 5e-25 42
Cthe_2333 YP_001038728.1 two component transcriptional regulator VFG0596 Protein 7e-28 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator VFG1563 Protein 5e-34 41
Cthe_2333 YP_001038728.1 two component transcriptional regulator VFG1702 Protein 6e-34 41