Gene Information

Name : Cthe_1600 (Cthe_1600)
Accession : YP_001038019.1
Strain : Clostridium thermocellum ATCC 27405
Genome accession: NC_009012
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1931928 - 1932602 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulatory protein-like; KEGG: sak:SAK_1922 phosphate regulon transcriptinal regulatory protein PhoB, putative

DNA sequence :
ATGATCTATTGTGTAGAGGACGATAGAAGCATTCGGGAGCTTATCATATATGCACTGAAATCCAATGGTTATGAGGCTGT
AGGCTTTGACAAAGCTGAGCCATTTTATAAAGAATTGGAAAATAAGCTACCCGATTTAGTATTGCTTGATATCATGTTGC
CCGGCGAAGATGGTATTGAAATATTGAAAAAACTAAAGGCATCACCGAAACTACGAAATATTCCGGTAATCATGCTTACT
GCAAAAAGCGCAGAATATGACAAGGTTTTAGGGCTGGACAGTGGAGCAGATGATTATATTACCAAGCCTTTTGGTATTAT
GGAGTTCCTTTCCCGTGTCAAAGCAGTTCTCAGAAGATCAGGAAATGTAAGTAATTCATCTGAAATATCTGTTGGACAGC
TAACGATGTATATTGACAAGCATGTTGTTATAGCAGACGGGAAAGAGGTTGCTCTTACGTTCAAAGAATTTGAGCTTCTG
AAATATTTGATGGAAAATGCTGGCATTGTGCTGACAAGGGATAAGCTCCTGGAGGAAGTATGGGGATATGAATATGAAGG
CGAAACTCGTACTTTGGATGTGCATATCCGTACCCTGCGGCAGAAGCTTGGAGAAGCGGGAGCGATTATTGAGACGGTGA
GAGGGGTTGGCTATAAGATCGGAGGAAAGGCATGA

Protein sequence :
MIYCVEDDRSIRELIIYALKSNGYEAVGFDKAEPFYKELENKLPDLVLLDIMLPGEDGIEILKKLKASPKLRNIPVIMLT
AKSAEYDKVLGLDSGADDYITKPFGIMEFLSRVKAVLRRSGNVSNSSEISVGQLTMYIDKHVVIADGKEVALTFKEFELL
KYLMENAGIVLTRDKLLEEVWGYEYEGETRTLDVHIRTLRQKLGEAGAIIETVRGVGYKIGGKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 6e-33 44
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 2e-28 41
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-42 46
Cthe_1600 YP_001038019.1 two component transcriptional regulator AE016830.1.gene2255. Protein 2e-33 44
Cthe_1600 YP_001038019.1 two component transcriptional regulator U35369.1.gene1.p01 Protein 2e-33 44
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-31 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-40 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-38 42
Cthe_1600 YP_001038019.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-37 42
Cthe_1600 YP_001038019.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-26 41
Cthe_1600 YP_001038019.1 two component transcriptional regulator AF310956.2.orf0.gene Protein 3e-35 41
Cthe_1600 YP_001038019.1 two component transcriptional regulator EU250284.1.orf4.gene Protein 7e-30 41
Cthe_1600 YP_001038019.1 two component transcriptional regulator AM180355.1.gene1830. Protein 5e-28 41
Cthe_1600 YP_001038019.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-26 41
Cthe_1600 YP_001038019.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cthe_1600 YP_001038019.1 two component transcriptional regulator VFG1389 Protein 2e-33 43
Cthe_1600 YP_001038019.1 two component transcriptional regulator VFG0473 Protein 3e-29 41