|
Name : rpmE2 (llmg_0906) Accession : YP_001032232.1 Strain : Lactococcus lactis MG1363 Genome accession: NC_009004 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 873207 - 873452 bp Length : 246 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACAAAATATCCATCCAAATTACCAACCAGTAGTCTTCATGGACACAACAACTGGTTACAAATTTTTGACTGGTTC AACTAAAGGTTCTAAAGAAACTGTTGAATGGGAAGACGGAAACACTTATCCATTGATTCGTGTTGAAATCTCTTCAGATT CACATCCATTCTACACAGGTCGTCAAAAATTCCAAGCAGCGGACGGACGTATCGCTCGTTTCGAAAAGAAATACGGCAAA CAATAA Protein sequence : MKQNIHPNYQPVVFMDTTTGYKFLTGSTKGSKETVEWEDGNTYPLIRVEISSDSHPFYTGRQKFQAADGRIARFEKKYGK Q |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 3e-12 | 47 |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 3e-12 | 47 |
