Gene Information

Name : llrC (llmg_0414)
Accession : YP_001031764.1
Strain : Lactococcus lactis MG1363
Genome accession: NC_009004
Putative virulence/resistance : Virulence
Product : two-component system regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 408233 - 408934 bp
Length : 702 bp
Strand : -
Note : Response regulator receiver domain, PhoB: Phosphate regulon transcriptional regulatory protein phoB; Conserved hypothetical protein

DNA sequence :
ATGAAAAAAATTCTTGTTGTTGATGATGAAAAACCAATCTCAGATATCGTAAAATTTAATTTAACCAAAGAAGGTTTTGA
AGTATTTACAGCTTTCGATGGCGAAGAAGCCCTTGAAGCTTTTAAAGAAGTACAACCTGACCTTATTTTACTTGATTTGA
TGTTACCAAAACTTGACGGTCTTGATGTTGCACGTGAAATCCGTAAAACCTCTGACACTCCTATTATCATGGTGTCAGCT
AAAGATAGCGAGTTTGATAAAGTTATTGGACTTGAACTTGGTGCAGATGACTATGTCACTAAACCATTCTCAAATCGCGA
ACTTTTAGCTCGTATTAAAGCAAACTTGCGTCGTATCAATGTCGCACCTGCTGAATCTACTGATAATGTTAAGAAAGAAT
TGATTATCGGAAATCTCCGTATCAATCCAGCACATTATGCTGCTTACAAAAATGATAAACAACTTGACCTCACACACCGT
GAGTTTGAATTACTTTACTATCTTGCTCAACACCTCGGCGAAGTTATCACTCGTGAAAATCTTTTGGAAACAGTTTGGGG
CTACGATTACTTTGGTGATGTGCGTACAGTTGACGTTACAGTCCGCCGCTTGCGTGAAAAAGTTGAAGATACACCAAGCC
GTCCACAATACGTTTCAACACGCCGCGGGGTTGGCTATTACATGAGCAACCCACATGATTAA

Protein sequence :
MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAFKEVQPDLILLDLMLPKLDGLDVAREIRKTSDTPIIMVSA
KDSEFDKVIGLELGADDYVTKPFSNRELLARIKANLRRINVAPAESTDNVKKELIIGNLRINPAHYAAYKNDKQLDLTHR
EFELLYYLAQHLGEVITRENLLETVWGYDYFGDVRTVDVTVRRLREKVEDTPSRPQYVSTRRGVGYYMSNPHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-25 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
llrC YP_001031764.1 two-component system regulator NC_012469.1.7685629. Protein 4e-63 73
llrC YP_001031764.1 two-component system regulator HE999704.1.gene2815. Protein 2e-41 53
llrC YP_001031764.1 two-component system regulator NC_003923.1003749.p0 Protein 1e-46 52
llrC YP_001031764.1 two-component system regulator NC_002952.2859905.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_007793.3914279.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_002745.1124361.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_009782.5559369.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_002951.3237708.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_002758.1121668.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_007622.3794472.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_009641.5332272.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_013450.8614421.p0 Protein 1e-46 51
llrC YP_001031764.1 two-component system regulator NC_012469.1.7686381. Protein 2e-37 51
llrC YP_001031764.1 two-component system regulator AE016830.1.gene1681. Protein 4e-38 48
llrC YP_001031764.1 two-component system regulator AE000516.2.gene3505. Protein 4e-25 46
llrC YP_001031764.1 two-component system regulator CP001138.1.gene4273. Protein 1e-30 46
llrC YP_001031764.1 two-component system regulator CP004022.1.gene3215. Protein 2e-29 46
llrC YP_001031764.1 two-component system regulator CP001918.1.gene5135. Protein 5e-26 46
llrC YP_001031764.1 two-component system regulator NC_002695.1.915041.p Protein 8e-30 45
llrC YP_001031764.1 two-component system regulator BAC0533 Protein 9e-31 45
llrC YP_001031764.1 two-component system regulator CP000034.1.gene3834. Protein 8e-30 45
llrC YP_001031764.1 two-component system regulator CP000647.1.gene4257. Protein 9e-31 45
llrC YP_001031764.1 two-component system regulator NC_014475.1.orf0.gen Protein 1e-31 43
llrC YP_001031764.1 two-component system regulator NC_005054.2598277.p0 Protein 1e-31 43
llrC YP_001031764.1 two-component system regulator HE999704.1.gene1528. Protein 2e-21 42
llrC YP_001031764.1 two-component system regulator AF162694.1.orf4.gene Protein 5e-27 42
llrC YP_001031764.1 two-component system regulator FJ349556.1.orf0.gene Protein 3e-30 42
llrC YP_001031764.1 two-component system regulator AE015929.1.gene1106. Protein 6e-21 42
llrC YP_001031764.1 two-component system regulator NC_011595.7057856.p0 Protein 2e-23 42
llrC YP_001031764.1 two-component system regulator NC_010410.6002989.p0 Protein 2e-23 42
llrC YP_001031764.1 two-component system regulator NC_010400.5986590.p0 Protein 6e-23 42
llrC YP_001031764.1 two-component system regulator CP000034.1.gene2186. Protein 3e-21 42
llrC YP_001031764.1 two-component system regulator NC_002695.1.916589.p Protein 2e-21 42
llrC YP_001031764.1 two-component system regulator BAC0039 Protein 3e-21 42
llrC YP_001031764.1 two-component system regulator AM180355.1.gene1830. Protein 1e-28 41
llrC YP_001031764.1 two-component system regulator AF155139.2.orf0.gene Protein 1e-28 41
llrC YP_001031764.1 two-component system regulator NC_007793.3914065.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_002758.1121390.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_010079.5776364.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_002952.2859858.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_007622.3794948.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_003923.1003417.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_013450.8614146.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator NC_002951.3238224.p0 Protein 1e-25 41
llrC YP_001031764.1 two-component system regulator CP000647.1.gene2531. Protein 2e-21 41
llrC YP_001031764.1 two-component system regulator BAC0596 Protein 3e-20 41
llrC YP_001031764.1 two-component system regulator CP001138.1.gene2239. Protein 3e-20 41
llrC YP_001031764.1 two-component system regulator CP001918.1.gene3444. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
llrC YP_001031764.1 two-component system regulator VFG1389 Protein 3e-23 44
llrC YP_001031764.1 two-component system regulator VFG1563 Protein 4e-25 42
llrC YP_001031764.1 two-component system regulator VFG1702 Protein 1e-24 42