Gene Information

Name : telC (llmg_1350)
Accession : YP_001032652.1
Strain : Lactococcus lactis MG1363
Genome accession: NC_009004
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1323752 - 1324327 bp
Length : 576 bp
Strand : -
Note : PF02342: Bacterial stress protein; Conserved hypothetical protein

DNA sequence :
ATGGTAATCAATCTTAAAAAAGGTCAAGGAATCAGTTTAAGAAAGGAAGCAGAAAATTTAACTAAAATTCGTTTAGGAAT
GGGATGGGATCCAGCCAATAATGGATTTGATTTTGATTTGGATGCCTCTGCCTTTCTTCTTGCGGAAAACGGAAAATGTA
CGAGAGAAGAAGATTTTGTTTTTTATAATAATTTATCAGATAATTCTGGTGCTTTAGAACACTCTGCAGATGATCGCACG
GGTGGTTCAAGTGCAACTGGTGACGATGAATATATTATTGTAGATCTTAGTAAACTTCCTGAAAAATACAAAAAAATTGT
GTTTGTTGTTACTATCGACAATTATGAAGAACGCCATCAAAATTTTGGTATGGTAGAAAATGCTTATGTAAGACTTTTAG
ACGAAACATCCGATCGAGAAATCGCAAGATATGACTTGACAGAAGATTTGCCAATCGAAACATCACTAACGTTCTGTGAG
CTTGTTCGTCAAGCTGATGGCTGGCATTTTGAAACGATTGGAGTTGGAGAGCGCATAGGCTTACTATCATATCTAGAACG
ATATGGTTTAGCTTAA

Protein sequence :
MVINLKKGQGISLRKEAENLTKIRLGMGWDPANNGFDFDLDASAFLLAENGKCTREEDFVFYNNLSDNSGALEHSADDRT
GGSSATGDDEYIIVDLSKLPEKYKKIVFVVTIDNYEERHQNFGMVENAYVRLLDETSDREIARYDLTEDLPIETSLTFCE
LVRQADGWHFETIGVGERIGLLSYLERYGLA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-41 49
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-37 46
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-38 45
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-38 45
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-38 45
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-35 43
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-35 43
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-35 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
telC YP_001032652.1 tellurium resistance protein BAC0389 Protein 3e-39 46
telC YP_001032652.1 tellurium resistance protein BAC0390 Protein 1e-37 44