|
Name : rpmF (llmg_0099) Accession : YP_001031461.1 Strain : Lactococcus lactis MG1363 Genome accession: NC_009004 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L32 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0333 EC number : - Position : 92948 - 93121 bp Length : 174 bp Strand : - Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not DNA sequence : ATGGCAGTACCTGCACGTCACACTTCATCAGCAAAGAAAAACCGTCGTCGTACACATTACAAATTGACAGCTCCAACTGT TACTTTTGACGAAACTACTGGTGACTACCGTCACTCACATCGCGTTTCACTTAAAGGCTACTACAAAGGCCGCAAAGTTC GCGACACTAAATAA Protein sequence : MAVPARHTSSAKKNRRRTHYKLTAPTVTFDETTGDYRHSHRVSLKGYYKGRKVRDTK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmF | NP_814315.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 1e-12 | 67 |
| ef0071 | AAM75276.1 | EF0071 | Not tested | Not named | Protein | 9e-13 | 67 |
| rpmF | NP_814351.1 | 50S ribosomal protein L32 | Not tested | Not named | Protein | 1e-11 | 67 |
| ef0104 | AAM75307.1 | EF0104 | Not tested | Not named | Protein | 9e-12 | 67 |
