Gene Information

Name : merP (Mpe_A1663)
Accession : YP_001020860.1
Strain : Methylibium petroleiphilum PM1
Genome accession: NC_008825
Putative virulence/resistance : Resistance
Product : PBP/HMA domain-containing protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1789143 - 1789427 bp
Length : 285 bp
Strand : +
Note : Hg2+/Cu export

DNA sequence : 
ATGAAGCTCGTCCCAATCCTGATGGCTGGCCTGCTCGCGTCTGCCGGAACCGCGGCTGCGGGCTCCCGCACCGTCACGCT
GGACGTGACCAAGATGGACTGCGCGGTGTGCCCGATCACCGTCCGCAAGGCCCTGGAGAAGGTGCCGGGCGTCGAGAACG
CCAAGGTCGACTTCAAGAGCAAGCGGGCGATCGTGGCGTTCGATCCCGCGAAGACCTCGCCAGAGGCACTCGCGCGGGCC
ACGGCCGACGCGGGGTTCCCTTCGTCCGTGAACCAGGGTCAGTGA

Protein sequence : 
MKLVPILMAGLLASAGTAAAGSRTVTLDVTKMDCAVCPITVRKALEKVPGVENAKVDFKSKRAIVAFDPAKTSPEALARA
TADAGFPSSVNQGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 1e-16 60
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 8e-16 59
merP AFG30122.1 MerP Not tested PAGI-2 Protein 6e-15 58
merP AGK07023.1 MerP Not tested SGI1 Protein 6e-15 58
merP AGK07081.1 MerP Not tested SGI1 Protein 6e-15 58
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 8e-15 58
merP ABQ57373.1 MerP Not tested SGI1 Protein 6e-15 58
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 6e-15 58
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 5e-14 53
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-14 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_001020860.1 PBP/HMA domain-containing protein BAC0678 Protein 1e-15 58
merP YP_001020860.1 PBP/HMA domain-containing protein BAC0679 Protein 7e-15 56
merP YP_001020860.1 PBP/HMA domain-containing protein BAC0231 Protein 9e-15 55
merP YP_001020860.1 PBP/HMA domain-containing protein BAC0675 Protein 3e-15 55
merP YP_001020860.1 PBP/HMA domain-containing protein BAC0674 Protein 1e-13 52