Gene Information

Name : Mpe_A1661 (Mpe_A1661)
Accession : YP_001020858.1
Strain : Methylibium petroleiphilum PM1
Genome accession: NC_008825
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1788305 - 1788718 bp
Length : 414 bp
Strand : -
Note : -

DNA sequence :
ATGAGAGAACAGATGTCGATTGGCCAGCTCGCTGCAGCGGCGGGGGTCAACGTCGAGACGGTCCGCTACTACCAGCGTCG
CAAGCTGCTGGCTGTCCCCGACCGCCCGGCTGGCGGCATCGGTAGGTATGCGCCACCGGCGCTGACCCGGCTTCGGTTCA
TCAAGCGCGCCCAGTCGCTGGGGTTCACCCTCGATGACGTGCAGGCGCTGCTGTCGCTCGACGATGGTCGGGGATGCTCG
GCAGCGCGCCAGATCGGCGAGGACAAGCTGGCAGACGTGCGGCAACGCCTGCAGGCCCTGCGGGTGCTCGAAGGAGCCTT
GCAGGAACTGGTGAGTCGCTGCGCGACCACGAAGCGCAAGGTGAACTGCCCGTTGATCGAAGCCTTGATGCAAACGGAGG
ATCTGCCGTCCTGA

Protein sequence :
MREQMSIGQLAAAAGVNVETVRYYQRRKLLAVPDRPAGGIGRYAPPALTRLRFIKRAQSLGFTLDDVQALLSLDDGRGCS
AARQIGEDKLADVRQRLQALRVLEGALQELVSRCATTKRKVNCPLIEALMQTEDLPS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-31 52
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 5e-28 49
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-31 49
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-32 49
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-30 48
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-30 48
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-30 48
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-30 48
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-30 48
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-30 48
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 5e-29 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0686 Protein 1e-30 51
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0688 Protein 2e-31 49
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0687 Protein 3e-31 48
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0684 Protein 7e-32 48
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0232 Protein 3e-31 48
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0689 Protein 3e-30 48
Mpe_A1661 YP_001020858.1 MerR family transcriptional regulator BAC0683 Protein 4e-31 46