Gene Information

Name : Mpe_A1629 (Mpe_A1629)
Accession : YP_001020826.1
Strain : Methylibium petroleiphilum PM1
Genome accession: NC_008825
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1760297 - 1760983 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence : 
ATGAAACTGCTTGTAGTCGAGGACGAGGTCAAGCTCGCCGAATACTTACGCAAAGGCCTCACCGAGTCGGGGTACGTGGT
CGACGTGGCCCATGACGGCATCGACGGCCTGCACCTTGCCATGGAAGGCAACTACGACCTGCTGGTGCTCGACAGCATGC
TGCCCGGCATCGACGGCCTGGCGCTGCTCGCAGCCTTGCGCAGGTCCAAACATACCCCGGTGCTGATGCTGACGGCACGG
GTCCACGTCGATGACCGCGTGCGGGGCCTGCAAGGGGGCGCGGACGACTACCTGACCAAACCCTTTGCCTTCACTGAACT
TACCGCGCGCATCCAGGTGTTGCTTCGACGCGCGGCTCCAAGTCAATCAGCGTCTGAGCCAACGCTGCTCCGCATCGCCG
ACCTTGAAGTGGACCTGCTGCGTCGCAAGGCGGTGCGAGCGGGCCAGCGCCTGGACCTGACAGCCAAGGAGTTCAGCCTT
CTGGCGCTGCTGATGCGACGGCAAGGCGAAGTGCTGTCACGCACCGAACTGGCCGCACAGGTGTGGGACATGAACTACGA
CAGCGAGACGAACGTCGTCGAGGTGGCGATCCGCCGCCTGCGCAACAAGTTCGATGCACCCTTCGAACAGGTTCTCCTGC
ACACGGTCCGGGGCATGGGCTACGTGCTCGAGGAGCGCCAACCTTGA

Protein sequence : 
MKLLVVEDEVKLAEYLRKGLTESGYVVDVAHDGIDGLHLAMEGNYDLLVLDSMLPGIDGLALLAALRRSKHTPVLMLTAR
VHVDDRVRGLQGGADDYLTKPFAFTELTARIQVLLRRAAPSQSASEPTLLRIADLEVDLLRRKAVRAGQRLDLTAKEFSL
LALLMRRQGEVLSRTELAAQVWDMNYDSETNVVEVAIRRLRNKFDAPFEQVLLHTVRGMGYVLEERQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-55 53
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-54 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0197 Protein 6e-65 61
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0125 Protein 2e-64 60
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0083 Protein 5e-61 59
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0111 Protein 5e-61 56
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0638 Protein 5e-55 56
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0308 Protein 3e-56 55
Mpe_A1629 YP_001020826.1 two-component response regulator BAC0347 Protein 6e-54 51
Mpe_A1629 YP_001020826.1 two-component response regulator HE999704.1.gene1528. Protein 4e-34 44
Mpe_A1629 YP_001020826.1 two-component response regulator NC_002516.2.879194.p Protein 1e-31 43
Mpe_A1629 YP_001020826.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-35 41
Mpe_A1629 YP_001020826.1 two-component response regulator AE015929.1.gene1106. Protein 2e-31 41
Mpe_A1629 YP_001020826.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mpe_A1629 YP_001020826.1 two-component response regulator VFG0596 Protein 8e-56 53
Mpe_A1629 YP_001020826.1 two-component response regulator VFG1389 Protein 3e-37 46
Mpe_A1629 YP_001020826.1 two-component response regulator VFG1390 Protein 1e-41 44
Mpe_A1629 YP_001020826.1 two-component response regulator VFG0473 Protein 3e-31 42