Name : ureA (A9601_08931) Accession : YP_001009284.1 Strain : Prochlorococcus marinus AS9601 Genome accession: NC_008816 Putative virulence/resistance : Virulence Product : urease subunit gamma Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0831 EC number : 3.5.1.5 Position : 767784 - 768086 bp Length : 303 bp Strand : + Note : UreA, with UreB and UreC catalyzes the hydrolysis of urea into ammonia and carbon dioxide; nickel metalloenzyme; accessory proteins UreD, UreE, UreF, and UreG are necessary for assembly of the metallocenter DNA sequence : ATGCATCTTTCACCTCAAGAAAAGGATAAATTATTGATTTTTTCTGCTGCGCTATTAGCTGAAAGAAGGCTTAGTCGAGG TCTTAAGCTTAATTATCCTGAAACAATTGCTTTTTTAAGTTTTCAAGTTCTTGAAGGAGCACGAGATGGTAAAAGTGTAA GTCAATTAATGTCAGAGGGAACTACCTGGCTTTCAAAATCACAAGTTATGGAGGGCATTCCTGAAATGGTTGATGAAGTT CAAATAGAAGCGGTTTTCCCCGATGGGACTAAATTAGTTACTATTCACAATCCAATTAATTAG Protein sequence : MHLSPQEKDKLLIFSAALLAERRLSRGLKLNYPETIAFLSFQVLEGARDGKSVSQLMSEGTTWLSKSQVMEGIPEMVDEV QIEAVFPDGTKLVTIHNPIN |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 6e-26 | 70 |
ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 6e-26 | 70 |
ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 7e-29 | 63 |
ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 7e-29 | 63 |
ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 7e-29 | 63 |
ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 7e-29 | 63 |